Details for Arabidopsis Locus AT3G12000

Position : Chr3 ( 5`- 3818262 .. 3819620 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12000

Protein [Map View]
MRGVTPNYYHSYTFFFFFFVVLLALFLHVFSINTLSSTETLTISSNRTIVSPGNIFELGFFKTTTSSRNGDHWYLGIWYK
SISERTYVWVANRDNPLSKSIGTLKISYANLVLLDHSGTLVWSTNLTRTVKSPVVAELLDNGNFVLRDSKGNYQNRFLWQ
SFDYPVDTLLPEMKIGRDLKTGHETFLSSWRSPYDPSSGDFSFKLGTQGLPEFYLFKKEFLLYRSGPWNGVGFSGIPTMQ
NWSYFDVVNNFIENRGEVAYSFKVTDHSMHYVRFTLTTERLLQISRWDTTSSEWNLFGVLPTEKCDLYQICGRDSYCDTK
TSPTCNCIKGFVPKNVTAWALGDTFEGCVRKSRLNCHRDGFFLLMKRMKLPGTSTAIVDKTIGLNECKERCSKDCNCTGF
ANKDIQNGGSGCVIWTGGAHGYEELRRRRSRSICQNRPL*

DNA
ATGAGAGGCGTAACACCAAACTATTACCATTCTTACACTTTCTTCTTCTTCTTCTTCGTTGTCTTATTAGCTCTGTTTCT
TCATGTTTTCTCGATAAACACTTTGTCATCTACAGAAACTCTAACAATCTCAAGCAACCGAACCATTGTGTCTCCCGGTA
ACATCTTCGAGCTAGGTTTCTTCAAAACTACAACAAGCTCTCGAAATGGTGATCATTGGTATCTTGGGATTTGGTACAAG
TCAATCTCTGAGAGAACTTATGTATGGGTTGCCAACAGAGATAACCCTCTTTCCAAGTCTATCGGAACATTAAAGATCTC
TTACGCTAACCTCGTCCTTCTTGATCATTCTGGTACTCTTGTTTGGTCAACGAATCTAACGAGAACGGTGAAATCTCCAG
TGGTGGCAGAGCTGCTCGATAACGGCAACTTCGTGCTTAGAGACTCCAAAGGCAACTATCAAAACCGATTCTTGTGGCAA
AGCTTTGATTATCCGGTGGACACATTACTCCCGGAGATGAAAATTGGTCGGGATCTCAAAACAGGACACGAGACTTTCCT
CAGTTCTTGGAGAAGCCCTTATGATCCCTCAAGCGGAGACTTCTCGTTCAAACTCGGAACTCAAGGGCTACCTGAGTTTT
ATCTTTTCAAGAAAGAGTTTCTATTGTACCGATCCGGTCCGTGGAATGGAGTCGGGTTTAGTGGCATACCGACGATGCAA
AACTGGAGCTACTTTGACGTTGTTAACAACTTCATAGAGAACAGAGGGGAAGTTGCTTATAGTTTCAAAGTCACCGACCA
TAGCATGCACTACGTGAGATTTACACTGACTACCGAAAGATTATTACAGATATCCAGATGGGATACGACATCATCGGAAT
GGAACTTGTTTGGCGTTTTACCGACCGAGAAATGCGATTTGTACCAAATATGTGGTCGTGATAGTTATTGTGACACGAAA
ACATCACCGACGTGTAACTGTATCAAAGGCTTTGTTCCAAAGAATGTGACGGCTTGGGCTTTGGGAGATACATTTGAGGG
ATGTGTGAGGAAGTCACGACTGAACTGCCACAGAGATGGGTTTTTTCTTTTGATGAAGAGGATGAAGCTGCCTGGTACAA
GCACAGCAATTGTGGACAAGACAATTGGGTTGAATGAATGTAAGGAGAGGTGTTCTAAGGATTGTAATTGTACCGGGTTT
GCGAATAAGGATATCCAAAATGGTGGGTCGGGTTGTGTGATTTGGACCGGAGGAGCTCATGGATATGAGGAATTACGTCG
TCGGAGGTCAAGATCTATATGTCAAAATAGGCCTCTATAA