Details for Arabidopsis Locus AT3G11960

Position : Chr3 ( 5`- 3786386 .. 3793657 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11960

Protein [Map View]
MAAPEDESSAQSQSSPATAAPTPPPSSSPSSAGDHYLAKCILRPSVVLQVAYGYFRSPSSRDIVFGKETCIELVVIGEDG
IVESVCEQYVFGTIKDLAVIPQSSKLYSNSLQMGKDLLAVLSDSGKLSFLSFSNEMHRFSPIQHVQLSTPGNSRIQLGRM
LTIDSSGLFLAVSAYHDRFALFSLSTSSMGDIIHQRISYPSEDGGNGSSIQAISGTIWSMCFISKDFNESKEYAPILAIV
INRKGSLMNELALFRWNVKEESICLISEYVETGALAHSIVEVPHSSGFAFLFRIGDVLLMDLRDPQNPCCLFRTSLDFVP
ASLMEEHFVEESCRVQDGDDEGCNVVVCALLELRDHEVRDHDPMFIDTESDIGKLSSKNVSSWTWEPENNHNPRMIICLD
NGDFFMFELIYEDDGVKVNLSECLYKGLPCKDILWIEGGFLATFAEMADGTVFKLGTEKLHWMSSIQNIAPILDFSVMDD
QNEKRDQIFACCGVTPEGSLRIIRSGINVEKLLKTAPVYQGITGTWTVKMKLTDVYHSFLVLSFVEETRVLSVGLSFKDV
TDSVGFQSDVCTFACGLVADGLLVQIHQDAIRLCMPTMDAHSDGIPVSSPFFSSWFPENVSISLGAVGQNLIVVSTSNPC
FLSILGVKSVSSQCCEIYEIQRVTLQYEVSCISVPQKHIGKKRSRDSSPDNFCKAAIPSAMEQGYTFLIGTHKPSVEVLS
FTEDGVGVRVLASGLVSLTNTMGTVISGCIPQDVRLVLVDQLYVLSGLRNGMLLRFEWAPFSNSSGLNCPDYFSHCKEEM
DTVVGKKDNLPVNLLLIATRRIGITPVFLVPFSDSLDSDIIALSDRPWLLQTARQSLSYTSISFQPSTHATPVCSFECPQ
GILFVSENCLHLVEMVHSKRRNAQKFQLGGTPRKVIYHSESKLLIVMRTDLYDTCTSDICCVDPLSGSVLSSYKLKPGET
GKSMELVRVGNEHVLVVGTSLSSGPAILPSGEAESTKGRVIILCLEHTQNSDSGSMTICSKACSSSQRTSPFHDVVGYTT
ENLSSSSLCSSPDDYSYDGIKLDEAETWQLRLASSTTWPGMVLAICPYLDHYFLASAGNAFYVCGFPNDSPERMKRFAVG
RTRFMITSLRTYFTRIVVGDCRDGVLFYSYHEESKKLHQIYCDPAQRLVADCFLMDANSVAVSDRKGSIAILSCKDHSDF
GMKHLEYSSPESNLNLNCAYYMGEIAMSIKKGCNIYKLPADDVLRSYGLSKSIDTADDTIIAGTLLGSIFVFAPISSEEY
ELLEGVQAKLGIHPLTAPVLGNDHNEFRGRENPSQARKILDGDMLAQFLELTNRQQESVLSTPQPSPSTSKASSKQRSFP
PLMLHQVVQLLERVHYALH*

DNA
ATGGCGGCTCCGGAGGATGAATCTTCCGCTCAGTCTCAATCATCACCTGCCACGGCGGCTCCTACGCCTCCTCCTTCCTC
TTCCCCTTCCTCTGCTGGGGATCACTACCTAGCTAAGTGCATCCTCCGCCCCAGCGTCGTTCTCCAGGTTGCTTATGGCT
ACTTCCGCTCCCCTTCCTCCCGCGACATAGTTTTCGGCAAGGAGACCTGCATAGAATTGGTGGTTATTGGTGAAGACGGG
ATTGTTGAATCGGTGTGTGAACAGTATGTATTTGGAACAATTAAGGATTTGGCTGTCATACCTCAGAGTAGCAAGCTTTA
TTCGAATAGTTTGCAGATGGGAAAAGACCTTCTGGCTGTTCTTTCTGATTCTGGAAAGCTCTCATTTCTCTCATTTAGCA
ATGAAATGCACAGGTTCTCGCCAATACAACATGTTCAACTTTCTACTCCAGGTAACTCAAGGATTCAACTCGGAAGAATG
CTCACAATAGATTCCAGTGGTCTCTTTCTTGCTGTCAGTGCGTATCATGACCGTTTTGCTCTGTTTTCCCTCTCAACATC
GTCTATGGGTGATATTATTCATCAGAGGATTTCTTATCCTTCTGAAGACGGAGGGAATGGTAGCTCTATTCAAGCAATAT
CTGGTACTATTTGGAGCATGTGCTTCATTTCTAAAGATTTTAATGAATCCAAGGAGTATGCTCCTATTCTTGCCATTGTT
ATAAATAGGAAAGGGTCCCTCATGAATGAGCTGGCTTTGTTTAGATGGAATGTCAAAGAGGAATCCATATGTTTAATATC
AGAGTATGTTGAAACTGGGGCTCTGGCACATAGTATTGTCGAAGTTCCTCACTCCTCTGGATTTGCCTTTCTGTTTAGGA
TTGGTGATGTTCTCTTAATGGATCTAAGAGATCCTCAAAACCCTTGCTGTCTGTTTAGGACATCCTTAGATTTTGTTCCT
GCTTCATTAATGGAAGAGCATTTTGTTGAAGAGTCGTGTAGAGTACAAGATGGAGACGATGAGGGCTGTAATGTTGTTGT
ATGTGCTTTGTTAGAGCTCAGGGATCATGAGGTCAGGGATCATGATCCCATGTTCATAGATACTGAAAGTGACATTGGAA
AGTTGAGTTCTAAGAACGTCTCTTCATGGACTTGGGAGCCGGAAAATAATCATAATCCTCGGATGATTATTTGCTTAGAT
AATGGTGATTTTTTCATGTTTGAACTCATATATGAAGATGATGGGGTTAAAGTAAATCTATCAGAGTGTTTATACAAAGG
TTTACCATGCAAGGATATTTTATGGATCGAAGGTGGATTCCTTGCTACATTTGCAGAAATGGCAGATGGAACGGTTTTCA
AATTGGGAACTGAGAAGCTACATTGGATGAGTTCCATACAAAATATTGCTCCGATCTTGGATTTTTCGGTTATGGATGAC
CAGAATGAAAAACGAGACCAAATATTTGCTTGTTGTGGTGTAACCCCTGAAGGCTCTCTGAGAATTATTCGTAGTGGCAT
TAATGTAGAAAAACTTCTGAAAACCGCGCCTGTTTATCAAGGAATAACTGGTACTTGGACTGTTAAAATGAAGCTTACTG
ATGTATACCATTCATTTCTTGTTTTGTCATTTGTTGAGGAGACCAGGGTTTTATCAGTTGGATTAAGTTTTAAAGATGTC
ACTGATTCAGTTGGTTTCCAGTCTGATGTTTGCACCTTCGCATGTGGGCTTGTTGCTGATGGTTTGTTGGTTCAGATTCA
TCAAGATGCAATTAGGCTGTGCATGCCTACAATGGATGCTCATTCTGATGGTATTCCTGTTTCTTCACCATTTTTCTCAT
CGTGGTTTCCAGAAAATGTCAGTATCAGCTTGGGGGCAGTTGGTCAAAATTTGATAGTTGTCTCTACGTCTAACCCTTGT
TTCTTGTCTATTCTTGGGGTCAAATCAGTATCATCTCAATGCTGTGAAATCTATGAAATTCAACGAGTAACATTGCAGTA
TGAAGTTTCCTGCATCTCAGTTCCTCAAAAACATATTGGAAAAAAGAGATCCCGTGATTCTTCCCCGGATAATTTTTGCA
AAGCTGCGATTCCTTCTGCTATGGAGCAAGGCTATACATTTTTGATTGGCACACATAAGCCTTCTGTTGAGGTCCTTTCC
TTCACAGAAGATGGTGTTGGTGTTCGAGTCCTTGCTTCTGGGTTGGTATCGCTAACAAATACAATGGGAACTGTTATTAG
TGGGTGCATTCCTCAAGATGTAAGACTCGTGTTAGTTGATCAACTTTATGTCCTTTCTGGGTTGAGAAATGGGATGCTTC
TCCGTTTTGAGTGGGCCCCTTTTTCAAATTCATCCGGGTTGAATTGTCCAGATTATTTTAGTCACTGTAAAGAGGAGATG
GACACTGTTGTGGGCAAAAAAGACAATTTACCAGTCAACCTTCTGTTAATTGCTACCCGACGCATTGGCATCACACCTGT
TTTCTTGGTTCCGTTCAGTGATTCACTGGATTCAGACATCATAGCTCTTAGTGACAGGCCATGGTTGTTACAAACAGCTC
GACAAAGCCTTTCCTATACTTCCATCTCATTCCAACCTTCTACTCATGCAACTCCTGTATGCTCGTTTGAATGCCCCCAA
GGAATTCTTTTTGTTTCAGAGAACTGTTTACATCTGGTGGAGATGGTGCACAGCAAACGGCGTAATGCGCAAAAGTTTCA
GCTTGGAGGCACCCCGCGAAAGGTTATCTACCACAGTGAAAGCAAATTATTGATTGTGATGAGAACTGATCTGTATGATA
CATGTACGTCTGATATATGCTGTGTAGACCCGCTCAGTGGGTCAGTGTTATCATCCTACAAGCTCAAACCTGGAGAGACT
GGAAAGTCAATGGAGCTTGTACGTGTGGGAAATGAACATGTCCTTGTGGTTGGGACGAGTTTGTCTTCTGGTCCTGCTAT
ACTACCCAGTGGTGAAGCTGAAAGTACAAAAGGACGAGTAATCATCCTCTGCTTAGAACACACTCAAAACTCGGATAGTG
GTTCAATGACAATTTGTTCAAAGGCTTGTTCGTCTTCCCAACGTACATCACCTTTCCATGATGTTGTGGGATACACAACA
GAAAACCTATCAAGCAGTAGCCTCTGCAGCAGTCCAGATGATTACAGCTATGATGGAATCAAACTTGATGAAGCTGAAAC
ATGGCAGTTAAGATTGGCCTCTTCAACCACTTGGCCGGGTATGGTACTTGCAATCTGTCCATACCTTGATCATTACTTCC
TGGCATCTGCCGGCAATGCTTTCTATGTCTGTGGTTTTCCGAACGATAGTCCTGAGAGAATGAAGAGGTTTGCGGTAGGA
AGGACCCGTTTCATGATAACATCTCTGCGCACATACTTCACTAGAATTGTTGTTGGGGATTGCCGTGATGGTGTTCTATT
TTATTCTTATCACGAGGAATCAAAGAAACTTCACCAAATATATTGTGATCCAGCGCAGAGGTTAGTTGCTGACTGTTTTC
TAATGGATGCTAATTCCGTTGCTGTATCTGATCGCAAGGGGAGTATAGCAATCCTGTCTTGCAAAGATCATTCAGACTTT
GGTATGAAGCACCTTGAATATTCAAGTCCGGAGTCCAACCTGAATCTAAACTGTGCTTATTACATGGGAGAGATTGCCAT
GTCTATAAAAAAGGGTTGCAACATCTACAAACTTCCAGCTGATGATGTACTGCGAAGTTATGGTCTTAGTAAAAGTATTG
ACACAGCTGATGACACTATCATAGCAGGCACGCTATTGGGAAGTATATTTGTGTTTGCTCCTATTTCAAGCGAGGAATAT
GAGCTCTTAGAAGGTGTCCAAGCAAAGCTTGGGATCCATCCCCTGACTGCTCCTGTACTTGGTAATGATCATAATGAGTT
CCGAGGTCGAGAGAATCCGTCCCAAGCGAGAAAGATATTGGATGGTGACATGCTTGCTCAGTTCTTGGAGCTTACAAATA
GACAGCAGGAGTCAGTTTTATCGACACCTCAGCCATCACCAAGCACATCAAAAGCAAGTTCAAAGCAACGTTCTTTCCCG
CCTCTCATGCTACACCAAGTTGTACAGTTGCTTGAGCGTGTCCATTACGCTTTGCACTAG