Details for Arabidopsis Locus AT3G11950

Position : Chr3 ( 5`- 3783111 .. 3785660 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11950

Protein [Map View]
MDPPVSDLESIEDQKEGGPSFHCDLYDTQVVHKIAQVFLPGLATACVDNTTGDIFRSPGSVAADIRKEMIEYLTRRSETF
VAEHIVLQGGSEIEASHDPFDIISDFIDDFATSKRNLFSRVSGWMLSERREDNIDDFAQEMEISGFWLTDHREGIAQTLL
KNVDFKSSAHCEMKFQTEGELAEHAMNCGYRTMNCENEGCTAVFCANQMENHDSVCPFKIIPCEQNCSESIMRRDMDRHC
ITVCPMKLVNCPFHSVGCLSDVHQCEVQQHHLDNVSSHLMYILRSIYKEASLDDLKPRAEQIQQLSTRLSEARNARSLTN
LVKEIDGKLGPLEIKPKIVTDSESDKPENTEKKALEEAEIKEKPETSNLKAVTLEQTAREAPEDKLVSKEVDAAMVKEAA
KKVSEAEIADNVNEEGELKAQKLLEIGEFIKEGDNNSADDLSERTETKAPEVVVMDEAREEEDSVETKDTRTYETIRGLE
IEANEMIDEETKKSTETKTEAPSRIVMDKEGDEETKKSTETETEAPSRIVMETEKDEETMNSRARASDEAEALSKSSQGF
STVQAETVPHMS*

DNA
ATGGATCCTCCTGTGTCGGATCTTGAGAGTATTGAAGATCAGAAAGAAGGAGGACCTTCCTTTCACTGTGATCTTTACGA
TACACAAGTAGTTCACAAGATTGCTCAGGTTTTTCTCCCTGGTTTAGCCACTGCTTGTGTCGATAACACTACCGGAGATA
TCTTCAGGAGTCCTGGTTCTGTTGCTGCTGACATTCGAAAAGAAATGATAGAGTACTTGACTCGTAGAAGCGAAACCTTT
GTGGCTGAACACATTGTTCTTCAAGGAGGTTCTGAGATTGAAGCTTCTCATGATCCTTTTGACATTATATCTGATTTCAT
CGATGATTTCGCCACTTCTAAGCGGAATTTGTTCAGCCGGGTTTCGGGTTGGATGCTTAGCGAAAGGAGAGAAGATAATA
TCGATGATTTCGCGCAAGAGATGGAGATAAGCGGGTTTTGGTTGACTGATCATAGAGAAGGTATCGCTCAGACTTTGCTT
AAAAACGTTGATTTTAAAAGCAGTGCACATTGTGAGATGAAATTCCAAACCGAAGGAGAACTCGCCGAGCACGCCATGAA
TTGTGGGTATAGAACAATGAACTGTGAGAATGAGGGTTGTACTGCGGTGTTTTGTGCGAATCAGATGGAGAATCACGATT
CTGTTTGCCCGTTCAAGATCATTCCGTGTGAGCAGAACTGCTCAGAGAGTATCATGAGACGTGATATGGATAGGCATTGT
ATAACCGTATGTCCTATGAAACTTGTCAACTGTCCATTTCATTCTGTTGGTTGTCTCTCTGATGTACATCAATGTGAGGT
CCAACAACATCATTTGGATAATGTTAGCTCTCATTTGATGTACATTCTTCGGAGTATTTACAAGGAAGCATCTCTGGATG
ATCTCAAACCCCGAGCTGAACAGATACAGCAGTTGTCTACTAGGTTATCTGAAGCTCGTAATGCAAGATCACTAACAAAT
CTGGTCAAGGAAATTGATGGAAAGCTGGGGCCTTTAGAAATCAAACCAAAGATTGTTACTGACTCGGAATCCGATAAACC
TGAAAATACAGAAAAGAAAGCCTTAGAAGAAGCTGAGATTAAAGAAAAACCAGAGACGAGTAACTTAAAAGCTGTTACAT
TGGAGCAAACCGCGAGAGAAGCTCCGGAAGATAAATTGGTTTCAAAAGAAGTAGATGCTGCAATGGTGAAAGAAGCTGCA
AAGAAAGTTTCAGAAGCTGAGATAGCAGACAATGTTAATGAAGAAGGCGAATTAAAAGCGCAGAAGCTTTTAGAAATAGG
CGAGTTCATCAAAGAAGGAGACAACAACTCTGCAGATGATTTATCAGAGAGAACCGAAACCAAAGCTCCAGAAGTTGTGG
TCATGGATGAGGCTAGAGAGGAGGAGGATAGTGTAGAGACAAAAGACACAAGAACATATGAAACAATCAGAGGTTTAGAG
ATTGAAGCCAATGAAATGATTGATGAAGAGACAAAGAAATCGACTGAAACCAAAACCGAAGCTCCATCAAGAATAGTCAT
GGACAAAGAGGGGGATGAAGAGACAAAGAAATCAACTGAAACAGAAACCGAAGCTCCATCGAGAATAGTCATGGAGACAG
AGAAGGATGAAGAGACTATGAACTCTAGGGCTCGTGCTTCGGATGAAGCTGAAGCACTGTCAAAGAGCTCTCAAGGTTTT
TCTACGGTGCAAGCTGAAACCGTACCCCATATGTCTTAA