Details for Arabidopsis Locus AT3G11945

Position : Chr3 ( 5`- 3779839 .. 3782954 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11945

Protein [Map View]
MELSISQSPRVRFSSLAPRFLAASHHHRPSVHLAGKFISLPRDVRFTSLSTSRMRILAVALTFKSRCVYVNYEIPKDQIL
VGAAESDDPVLDRIARFQNACWRFLRPHTIRGTALGSTALVTRALIENTHLIKWSLVLKALSGLLALICGNGYIVGINQI
YDIGIDKVNKPYLPIAAGDLSVQSAWLLVIFFAIAGLLVVGFNFGPFITSLYSLGLFLGTIYSVPPLRMKRFPVAAFLII
ATVRGFLLNFGVYHATRAALGLPFQWSAPVAFITSFVTLFALVIAITKDLPDVEGDRKFQISTLATKLGVRNIAFLGSGL
LLVNYVSAISLAFYMPQVFRGSLMIPAHVILASGLIFQTWVLEKANYTKEAISGYYRFIWNLFYAEYLLFPFL*

DNA
ATGGAGCTCTCGATCTCACAATCACCGCGTGTTCGGTTCTCGTCTCTGGCGCCTCGTTTCTTAGCAGCTTCTCATCATCA
TCGTCCTTCTGTGCATTTAGCTGGGAAGTTTATAAGCCTCCCTCGAGATGTTCGCTTCACGAGCTTATCAACTTCAAGAA
TGCGCATATTAGCCGTTGCTTTGACTTTTAAGTCAAGATGTGTTTATGTGAACTATGAGATTCCTAAAGATCAAATCTTG
GTTGGTGCTGCTGAGTCTGATGATCCAGTGCTGGATAGAATTGCCCGGTTCCAAAATGCTTGCTGGAGATTTCTTAGACC
CCATACAATCCGCGGAACAGCTTTAGGATCCACTGCCTTGGTGACAAGAGCTTTGATAGAGAACACTCATTTGATCAAAT
GGAGTCTTGTACTAAAGGCACTTTCAGGTCTTCTTGCTCTTATTTGTGGGAATGGTTATATAGTCGGCATCAATCAGATC
TACGACATTGGAATCGACAAAGTGAACAAACCATACTTGCCAATAGCAGCAGGAGATCTATCAGTGCAGTCTGCTTGGTT
GTTAGTGATATTTTTTGCGATAGCAGGGCTTTTAGTTGTCGGATTTAACTTTGGTCCATTCATTACAAGCCTATACTCTC
TTGGCCTTTTTCTGGGAACCATCTATTCTGTTCCACCCCTCAGAATGAAAAGATTCCCAGTTGCAGCATTTCTTATTATT
GCCACGGTACGAGGTTTCCTTCTTAACTTTGGTGTGTACCATGCTACAAGAGCTGCTCTTGGACTTCCATTTCAGTGGAG
TGCACCTGTGGCGTTCATCACATCTTTTGTGACACTGTTTGCACTGGTCATTGCTATTACAAAGGACCTTCCTGATGTTG
AAGGAGATCGAAAGTTCCAAATATCAACCCTGGCAACAAAACTTGGAGTGAGAAACATTGCATTCCTCGGTTCTGGACTT
CTGCTAGTAAATTATGTTTCAGCCATATCACTAGCTTTCTACATGCCTCAGGTTTTTAGAGGTAGCTTGATGATTCCTGC
ACATGTGATCTTGGCTTCAGGCTTAATTTTCCAGACATGGGTACTAGAAAAAGCAAACTACACCAAGGAAGCTATCTCAG
GATATTATCGGTTTATATGGAATCTCTTCTACGCAGAGTATCTGTTATTCCCCTTCCTCTAG