Details for Arabidopsis Locus AT3G11930

Position : Chr3 ( 5`- 3776237 .. 3777694 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11930

Protein [Map View]
MAEEQAATAMETSAVEKQPETTTEAEAPSLTTKRMVVAIDESDSSFYALQWVIDHFSNLLLTTAAAEAESGMLTVIHVQS
PFNHFAAFPAGPGGATAVYASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETLVLEGEAKEMICEAVEKMHVDLLV
VGSRGLGKIKRYCIINNFFLYINLSAYYFVCFVRFGRAFLGSVSDYCAHHANCPILIVKPPKEMTK*

DNA
ATGGCGGAAGAGCAAGCAGCGACGGCAATGGAAACATCGGCGGTGGAGAAGCAGCCAGAGACGACGACAGAGGCTGAAGC
ACCAAGTTTGACGACGAAGAGGATGGTGGTTGCGATTGATGAGAGCGACTCGAGCTTCTACGCTCTCCAATGGGTCATTG
ACCATTTCTCTAATCTTTTATTGACCACAGCGGCAGCTGAGGCGGAAAGTGGAATGCTCACGGTGATTCATGTGCAGTCC
CCTTTCAATCACTTTGCTGCCTTTCCGGCTGGACCGGGCGGCGCCACAGCAGTGTACGCATCTTCATCAATGATAGAGTC
AGTGAAAAAGGCACAACAAGAGACCTCTGCTGCCCTTCTCTCTCGCGCTCTCCAAATGTGCCGAGCCAAGCAGATACGTA
CTGAAACTCTAGTGCTAGAAGGCGAGGCGAAGGAGATGATTTGTGAGGCGGTGGAGAAAATGCACGTTGATCTTCTCGTT
GTGGGTAGTCGTGGCCTTGGCAAGATCAAAAGGTATTGTATCATTAATAACTTCTTCTTATATATAAATTTGAGCGCTTA
TTATTTTGTTTGCTTTGTGCGTTTCGGAAGAGCGTTTCTTGGGAGCGTTAGCGATTACTGCGCTCATCACGCCAACTGCC
CCATCCTTATTGTCAAGCCACCTAAGGAGATGACTAAGTAA