Details for Arabidopsis Locus AT3G11920

Position : Chr3 ( 5`- 3772311 .. 3774887 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11920

Protein [Map View]
MRFEESKNNCQNPRKSEKVTNGKSYTISSDIVSPPYSNSNPISDHVHPATPIPEAVSQSPMKEISIDDPYLPPHPQLPKL
EPPRGRRVSLEELLHPKEKFTGDLMKFIRQSGNAISKRISVLLENDDDDDSIDDVTEFKISGVKVLVKMKNEEEIKGRIT
FFSRSNCRDSTAVRLFLRERGFDFSEINIDVYSSREKELVERTGSSQVPQIFFNEKHFGGLMALNSLRNSGEFDRRVKEF
LKEKCCGDAPLPVMYGFDEESNNKDVVVVVDEMMRFVRVLRQKLPIKDRLMKMKIVKNCFSGAEMVEILIDYLDCGRKKA
VEIGKRLAEKHFIHHVFGENEFEDGNHYYRFLEHEPFVSKCYNFRGSTNDMEPQSAAIVGQKLFKIMTAILESYSSNDHT
SVDYMRISQSEEFRRYLNLAQDFHRLNLVELSTEEKLAFFLNLYNAMVIHALISIGRPEGLIARRSFFTDFQYVVGGYSY
SLSSIRNDILRRGRKPSYPFIRPPFNNGKTRHELGLLKLNPLVHFGLCDGTKSSPVVRFFTPQGVEAELKRAAREFFQNG
GIEVVLDKRTIHLSRIIKWYKEDFSEEKKMLKWIMGYIDSNDAGLLTHLLGDGGGSFNIVYQDYDWSTNN*

DNA
ATGAGGTTTGAGGAAAGTAAAAACAATTGTCAAAATCCGAGAAAATCTGAGAAAGTAACAAACGGCAAAAGTTACACTAT
CTCTTCGGATATTGTTTCACCTCCATATTCAAATTCAAATCCCATCAGTGATCACGTACATCCCGCCACACCCATTCCTG
AAGCCGTCTCTCAAAGTCCGATGAAAGAAATCTCAATCGATGATCCTTATCTCCCACCACATCCTCAGCTACCGAAACTT
GAACCGCCACGTGGCCGTCGTGTCTCTTTAGAAGAATTATTGCATCCGAAAGAGAAATTCACCGGCGATTTGATGAAATT
CATACGCCAAAGCGGGAACGCGATTTCGAAACGCATCTCGGTTTTGCTAGAGAACGACGATGACGACGACTCGATCGATG
ACGTGACCGAGTTCAAAATCTCTGGAGTGAAAGTTCTCGTGAAGATGAAAAACGAAGAAGAAATCAAAGGTCGTATAACT
TTCTTCTCCAGATCTAACTGCCGAGATTCAACCGCCGTCAGATTGTTTCTCCGGGAACGAGGATTTGATTTCTCGGAGAT
CAACATCGACGTGTATTCGTCAAGAGAGAAAGAGCTGGTTGAAAGAACAGGGAGTTCTCAAGTTCCTCAGATTTTCTTCA
ACGAGAAACACTTCGGAGGATTAATGGCGTTGAATTCTCTGAGAAACAGTGGTGAATTTGATCGGAGGGTTAAGGAGTTT
TTGAAGGAGAAGTGTTGCGGCGATGCACCGTTGCCGGTGATGTATGGATTCGACGAAGAGAGTAATAATAAGGATGTTGT
TGTTGTTGTTGATGAGATGATGAGATTCGTTAGGGTTTTGAGACAGAAGCTACCGATTAAGGATCGTTTGATGAAGATGA
AGATTGTTAAGAACTGTTTCTCCGGCGCCGAGATGGTCGAGATTCTCATTGATTACTTGGATTGCGGGAGGAAGAAGGCT
GTTGAAATAGGCAAGAGGTTAGCCGAGAAACACTTTATCCACCATGTCTTTGGAGAGAACGAGTTTGAAGATGGAAATCA
TTACTACCGTTTCCTAGAGCACGAGCCGTTTGTTTCAAAATGTTACAATTTTAGAGGTTCTACCAACGACATGGAGCCCC
AAAGTGCAGCCATTGTTGGGCAGAAGCTATTCAAAATCATGACAGCTATTCTCGAGTCTTATTCTTCCAATGACCACACT
AGTGTTGATTACATGAGAATCAGCCAGAGTGAAGAATTCCGAAGGTACTTGAATTTGGCTCAAGACTTCCACCGTTTGAA
TCTTGTGGAACTCTCAACGGAAGAGAAGTTAGCATTTTTTTTGAATTTGTACAACGCAATGGTGATTCATGCTTTGATCA
GTATCGGACGTCCCGAGGGGTTGATCGCAAGAAGGTCATTCTTTACGGATTTTCAGTATGTTGTAGGAGGCTACTCTTAT
TCACTTAGCTCCATCCGAAATGACATCCTTCGTCGCGGTCGAAAACCCTCTTATCCATTTATCAGGCCACCTTTTAATAA
CGGCAAGACACGGCATGAGCTTGGTCTTCTAAAACTGAATCCATTAGTACATTTTGGCTTATGCGATGGGACCAAATCAA
GTCCTGTGGTGAGGTTTTTCACACCGCAAGGAGTCGAAGCTGAGCTCAAACGAGCAGCTAGAGAGTTTTTTCAAAATGGT
GGAATTGAGGTTGTCTTGGACAAGAGGACCATACATCTATCAAGAATCATCAAGTGGTACAAAGAGGATTTCAGTGAAGA
GAAGAAAATGTTGAAGTGGATAATGGGTTATATAGATTCAAATGATGCAGGTCTTTTAACCCATCTGCTTGGTGATGGAG
GTGGTTCTTTTAACATCGTTTACCAAGATTATGATTGGTCTACCAACAATTGA