Details for Arabidopsis Locus AT3G11900

Position : Chr3 ( 5`- 3758452 .. 3760378 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11900

Protein [Map View]
MAIKDLTATTGDSSLPLIKSPPSETTGGDRTSALQTLGNIIVSIVGTGVLGLPYAFRIAGWLAGSLGVIIVGFATYYCML
LLIQCRDKLESEEGEEESKTYGDLGFKCMGTKGRYLTEFLIFTAQCGGSVAYLVFIGRNLSSIFSSYGLSMVSFILILVP
IEVGLSWITSLSALSPFSIFADICNIIAMCFVVKENVEMVIEGDFSFSDRTAISSTIGGLPFAGGVAVFCFEGFAMTLAL
ESSMREREAFPKLLAKVLAGITFVYVLFGFCGYMAYGDQTKDIITLNLPNNWSAIAVQIGLCVGLTFTFPIMVHPLNEII
EQKLKRIDWLQKHHNGYSNETGSVSKFAIFTTRTLLVVGLAAIASLVPGFGTFASLVGSTLCALISFVLPASYHLTLLGP
SLNVWNKSIDVFIVICGLIFAVYGTYNTIVGV*

DNA
ATGGCGATCAAAGACCTGACGGCGACGACCGGTGATTCATCTCTTCCTTTAATAAAATCTCCGCCGTCTGAAACAACCGG
CGGTGACAGAACCTCTGCTCTTCAAACGCTCGGTAACATTATCGTCTCCATCGTCGGTACAGGCGTCCTTGGTCTTCCTT
ACGCATTCCGCATCGCCGGTTGGTTAGCCGGATCTCTCGGTGTCATTATCGTCGGATTCGCCACCTATTACTGCATGCTC
CTCCTCATTCAGTGCAGAGATAAGCTAGAATCGGAAGAAGGAGAAGAAGAATCGAAAACTTATGGTGATTTAGGTTTCAA
ATGTATGGGAACAAAAGGTCGATACTTAACCGAATTCCTCATTTTCACTGCTCAATGTGGTGGATCAGTAGCGTATTTAG
TGTTCATAGGTCGAAACTTGTCATCCATATTTAGTTCGTATGGGTTAAGTATGGTTTCTTTCATATTGATTCTGGTTCCA
ATCGAAGTTGGATTGTCGTGGATCACTTCTTTATCAGCTCTCTCGCCTTTCAGTATCTTTGCTGATATATGCAACATCAT
AGCAATGTGTTTTGTTGTCAAAGAAAATGTGGAAATGGTGATTGAAGGAGACTTCTCGTTTAGTGATAGAACTGCTATTT
CGTCTACCATTGGTGGTTTACCTTTTGCTGGAGGAGTTGCGGTGTTCTGTTTTGAGGGTTTTGCAATGACGTTGGCTTTG
GAGAGTTCTATGAGGGAAAGAGAAGCTTTCCCTAAATTGTTAGCTAAAGTGCTTGCCGGGATTACGTTTGTCTATGTGTT
GTTCGGGTTTTGTGGTTATATGGCTTATGGTGATCAAACAAAGGATATCATCACTCTTAACCTCCCAAATAATTGGTCTG
CCATTGCTGTTCAGATTGGGTTATGTGTGGGATTGACGTTTACATTTCCGATCATGGTACATCCGCTTAACGAGATCATA
GAGCAGAAACTGAAGAGGATAGACTGGCTTCAAAAGCATCATAATGGGTACAGCAACGAAACAGGTTCAGTCTCAAAATT
TGCAATCTTTACAACGAGGACACTTTTGGTGGTAGGACTTGCAGCAATCGCGAGTTTAGTCCCAGGGTTTGGTACATTTG
CATCTCTTGTTGGAAGTACTTTGTGCGCACTCATCTCCTTTGTGTTGCCGGCTTCTTATCACCTCACGCTGCTCGGTCCA
TCACTAAATGTATGGAACAAATCCATCGACGTATTCATTGTGATTTGCGGGTTGATCTTTGCTGTTTATGGTACGTACAA
CACAATCGTCGGAGTGTGA