Details for Arabidopsis Locus AT3G11860

Position : Chr3 ( 5`- 3744816 .. 3746850 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11860

Protein [Map View]
MGTVDIFNGYKMYKWGEARSKRGEEIATMDVIIRQLELSKAGPSKLGFDGEEDAWVFVKKQRLFIVSPSLPLPQQQHFTL
EKPAISPQLEAGFRESMEVTQDSTFVHTVVPSLPLPEHFIRHKPETSESQAELRDVLADPHKTTHKPASSQSQVEFRDVM
EDTHGTTPLQTEMSSLPLPQHFVLQKPAGTSQSKADTRKATLVHTVMPSLPVPEHYILQFVFNNISEKNMIYEFLISFLF
QTFKYYLQYDKD*

DNA
ATGGGAACTGTGGATATTTTCAATGGCTACAAGATGTATAAGTGGGGTGAGGCGAGATCTAAACGCGGTGAGGAGATAGC
GACGATGGATGTTATAATTAGACAGTTGGAACTGAGCAAGGCTGGTCCTTCCAAGTTAGGATTTGATGGAGAAGAAGACG
CTTGGGTCTTTGTTAAAAAGCAGAGACTCTTCATTGTCTCGCCTTCTCTTCCACTTCCTCAACAACAGCATTTCACTTTG
GAGAAACCTGCAATATCTCCTCAATTAGAAGCTGGGTTTAGAGAAAGCATGGAGGTTACGCAAGATAGTACCTTTGTTCA
CACTGTGGTGCCTTCTCTTCCTCTGCCTGAACATTTCATTAGGCATAAGCCTGAAACTTCTGAGTCTCAAGCTGAATTAA
GAGACGTTCTTGCGGATCCGCACAAAACTACTCATAAGCCTGCGTCTTCTCAGTCACAAGTTGAGTTCAGAGACGTCATG
GAGGATACGCATGGAACTACTCCTCTTCAAACAGAGATGTCTTCTCTTCCATTACCTCAACACTTCGTTCTGCAGAAGCC
TGCTGGAACTTCTCAGTCAAAAGCGGATACACGCAAAGCTACTCTTGTTCACACGGTGATGCCTTCTCTTCCTGTACCTG
AACATTACATTCTGCAATTTGTTTTTAATAATATAAGTGAAAAGAATATGATATATGAATTCCTTATATCTTTTTTGTTT
CAAACTTTCAAGTATTATCTGCAATACGATAAAGACTAA