Details for Arabidopsis Locus AT3G11850

Position : Chr3 ( 5`- 3738897 .. 3741714 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11850

Protein [Map View]
MESPIKCCDCGCDCCSSSPGSWIRSVKKRRHDELQTEKRFSIPELDDLDMFSNPRVQIENECELLRETVSNQQQTIQDLY
HELEQERIASSTAADETVKMIQTLEREKAKIDLELKQLQRSVDETLNYENQEIEALENMVYQRDQTIQALTFETQAYKHR
MMSFGLTEAEADGERSLLSRNPSMIDFSSEYDCPTQDYPPLKCNINENQDPLEADIYVADDENYPPADSPHGRVHLKTLD
RRLSQMETNPSFTQLNRGRDVSEKGMVGESPRRQRHFRRISPTGSSSSHLGASKELRPDVFVDSPRSQSYSSKKMEDVSY
TENNNAKDDLSEIGDDMSDRVYTIDSVHHSSVAHSGGVAEQKIEDGASDGNVVFPREHTDLGDPDITKLYMRLQALEADR
ESMKHALLSMRTEKAQMVLLKEIAQHLSKEVVPQRRLPLRKASIAGPLTFTPVFKWITSFVSWKRKARRSKYMYGMSGNN
IGLQMLLEKVPRSRKWRCLRSTQV*

DNA
ATGGAATCTCCGATCAAATGTTGCGACTGTGGATGCGATTGTTGTTCTTCCTCCCCTGGTTCATGGATTCGATCTGTGAA
GAAGAGAAGACACGACGAATTACAGACCGAGAAACGATTCTCGATACCGGAGCTGGACGACCTAGACATGTTCTCTAATC
CTAGAGTCCAAATTGAGAACGAATGTGAATTACTACGCGAGACTGTTAGCAATCAACAGCAAACGATTCAGGATTTGTAT
CATGAGCTTGAGCAAGAGCGTATTGCTTCATCAACTGCTGCAGATGAAACAGTAAAGATGATTCAGACGTTGGAGCGTGA
AAAAGCAAAAATCGACTTGGAACTGAAACAGCTTCAGCGTAGTGTTGACGAAACATTGAATTATGAAAACCAAGAGATTG
AGGCATTGGAAAATATGGTTTATCAAAGGGATCAGACGATTCAGGCTCTTACGTTTGAAACTCAGGCTTATAAGCACAGA
ATGATGAGTTTTGGGCTAACCGAAGCAGAAGCTGATGGTGAGAGGAGCTTGCTTAGTCGTAACCCGAGCATGATCGACTT
TAGTTCTGAATATGACTGCCCTACACAAGATTACCCTCCTCTTAAATGCAATATTAATGAGAACCAAGACCCTCTTGAGG
CTGATATCTATGTTGCAGATGATGAGAACTATCCACCAGCTGATTCTCCTCATGGGAGAGTACATTTAAAGACTTTGGAT
CGAAGACTCAGCCAGATGGAGACGAATCCTAGCTTTACTCAGTTGAATAGAGGGAGGGATGTTTCAGAGAAGGGGATGGT
TGGTGAGAGTCCTAGGCGTCAAAGACATTTTAGGAGGATTTCCCCTACTGGTTCATCAAGTTCACACTTGGGAGCATCTA
AAGAACTAAGACCTGATGTTTTTGTTGATTCCCCGAGGTCCCAAAGCTACAGCTCTAAGAAAATGGAAGATGTCTCGTAT
ACAGAGAATAATAATGCTAAAGATGACTTGTCGGAAATAGGAGATGACATGAGTGATAGAGTTTATACCATTGATTCTGT
TCATCACAGCAGTGTGGCTCATAGTGGCGGTGTAGCGGAGCAGAAGATTGAGGATGGTGCTTCTGATGGCAATGTTGTTT
TCCCGAGAGAACACACGGATCTTGGTGATCCTGATATAACGAAACTCTACATGAGGCTTCAAGCACTGGAGGCTGACAGG
GAATCAATGAAACATGCGCTTCTCTCTATGAGGACTGAAAAGGCTCAAATGGTACTGTTGAAAGAAATTGCTCAACACTT
GTCAAAGGAAGTTGTCCCTCAACGGAGATTGCCTCTACGTAAAGCATCTATTGCTGGGCCATTGACTTTTACGCCGGTCT
TTAAGTGGATCACATCTTTTGTTTCCTGGAAAAGAAAGGCTCGTCGAAGCAAATACATGTATGGGATGTCAGGAAACAAC
ATCGGCTTGCAAATGCTTCTAGAAAAAGTCCCTCGGTCAAGGAAATGGCGATGTCTTAGGAGCACGCAAGTGTGA