Details for Arabidopsis Locus AT3G11830

Position : Chr3 ( 5`- 3732628 .. 3736377 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11830

Protein [Map View]
MASMMQPQIILLKEGTDTSQGKAQLVSNINACTAVGDVVRTTLGPRGMDKLIHDDKGSVTISNDGATIMKLLDIVHPAAK
ILVDIAKSQDSEVGDGTTTVVLLAAEFLKEAKPFIEDGVHAQNLIRSYRTASTLAIAKVKELAVSIEGKSVEEKKGLLAK
CAATTLSSKLIGGEKEFFATMVVDAVMAIGNDDRLNLIGIKKVPGGNMRDSFLVDGVAFKKTFSYAGFEQQPKKFLNPKI
LLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCVESGAKVVLSRLAIGDLATQYFADRDIFCAGRVAEE
DLNRVAAAAGGTVQTSVNNIIDEVLGTCEIFEEKQVGGERFNIFSGCPSGRTATIVLRGGADQFIEEAERSLHDAIMIVR
RAVKNSTVVPGGGAIDMEISKYLRQHSRTIAGKSQLFINSYAKALEVIPRQLCDNAGFDATDVLNKLRQKHAMQSGEGAS
YGVDINTGGIADSFANFVWEPAVVKINAINAATEAACLILSVDETVKNPKSESAQGDAAGAMGRGRGGGRGRGMRRR*

DNA
ATGGCATCGATGATGCAACCGCAGATCATACTGCTGAAGGAAGGGACGGACACATCTCAGGGCAAAGCGCAACTAGTAAG
CAACATCAACGCTTGCACTGCTGTTGGAGATGTAGTTCGAACCACGCTCGGGCCACGAGGGATGGACAAACTCATTCACG
ACGATAAAGGATCCGTCACCATTTCTAACGATGGTGCTACCATCATGAAGCTCCTCGACATTGTTCATCCTGCTGCTAAG
ATCCTCGTCGATATCGCCAAATCCCAAGACTCCGAGGTGGGTGATGGGACAACTACAGTGGTTCTTCTTGCAGCAGAGTT
TTTGAAGGAAGCGAAGCCATTTATTGAGGATGGTGTTCACGCTCAGAATCTAATTAGGAGTTACCGCACTGCAAGCACTT
TGGCAATTGCCAAGGTTAAAGAACTCGCTGTTAGCATTGAGGGGAAGAGTGTAGAGGAAAAGAAAGGTTTATTGGCTAAA
TGTGCTGCTACGACTCTCTCATCTAAGCTTATCGGTGGAGAAAAGGAGTTTTTTGCTACAATGGTTGTTGATGCTGTTAT
GGCCATTGGGAATGACGACAGGCTAAATCTGATTGGGATCAAGAAGGTTCCTGGTGGCAATATGCGAGACTCTTTCCTCG
TTGATGGTGTAGCTTTCAAAAAAACATTCTCGTATGCTGGTTTTGAGCAACAGCCAAAGAAATTTCTTAACCCCAAAATT
CTCTTGCTTAACATCGAATTGGAGTTGAAATCTGAGAAGGAAAACGCTGAAATTAGGCTGTCAGATCCATCACAGTACCA
GTCAATAGTTGATGCAGAATGGAATATCATTTATGACAAACTAGACAAATGTGTTGAGAGTGGAGCAAAAGTTGTTCTTT
CTCGATTGGCTATTGGTGATCTAGCTACTCAGTATTTTGCCGATCGTGATATTTTCTGTGCTGGTCGTGTTGCTGAGGAA
GATCTTAACCGTGTGGCTGCTGCAGCTGGAGGAACAGTTCAGACAAGTGTTAACAACATAATAGATGAGGTTCTTGGAAC
TTGTGAGATTTTTGAGGAAAAACAAGTTGGTGGGGAGAGATTTAATATATTCAGTGGTTGCCCTTCAGGACGAACAGCAA
CTATTGTTCTCCGTGGTGGAGCTGATCAGTTCATCGAAGAAGCTGAGCGGAGTTTACATGATGCGATTATGATTGTGAGA
AGAGCTGTGAAGAACTCAACTGTTGTTCCTGGAGGTGGAGCTATAGATATGGAGATAAGCAAGTACCTGAGGCAGCATTC
AAGAACAATTGCTGGGAAGTCACAGCTTTTCATCAACTCTTATGCGAAGGCTCTAGAGGTTATTCCACGACAGTTATGTG
ATAATGCTGGATTTGATGCAACTGACGTCTTGAATAAACTTAGACAAAAACACGCCATGCAAAGCGGTGAAGGAGCTTCG
TATGGAGTGGACATTAACACTGGTGGCATAGCAGATTCTTTTGCTAACTTCGTTTGGGAACCAGCAGTTGTGAAGATCAA
CGCAATAAATGCTGCGACTGAAGCGGCTTGCCTCATTCTTAGTGTCGACGAAACCGTGAAGAACCCTAAATCTGAGAGCG
CACAGGGAGACGCCGCAGGTGCAATGGGGAGAGGACGCGGTGGAGGTCGTGGCCGTGGAATGCGAAGGCGATAA