Details for Arabidopsis Locus AT3G11800

Position : Chr3 ( 5`- 3726108 .. 3727729 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11800

Protein [Map View]
MARFFLLCCLFAAVLTSSLTEAGDNNQVYSPCSDSTVAIGDGFTFGIAFAAKDSFFSTNRSKSVQYSPCDHRHLSLNGNS
EVAVFRPKVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYAARSLPIMVADSNHIVTSFTLVLEFQKGRLENMFWKKD
GCSKCSGDSKFVCLNKEECAIKPQNCKNQGGQVDCSLGIQLAFSGTDKHYTALNSWYEVANLKQYSLYGLYSNLKDSLTN
PFKNIF*

DNA
ATGGCTAGATTCTTTCTTCTCTGTTGCCTCTTCGCGGCGGTGCTGACGTCATCATTGACGGAGGCCGGCGACAATAATCA
AGTCTACTCGCCTTGTTCAGATTCTACTGTTGCGATCGGCGATGGATTCACTTTCGGCATTGCCTTCGCTGCGAAAGATT
CTTTCTTCAGTACAAATCGATCCAAATCCGTTCAGTACTCTCCCTGCGATCATCGCCATCTCTCGCTCAACGGAAACTCT
GAGGTCGCCGTGTTCAGACCTAAAGTCGATGAGATCACACTCCTTACCATCAATACCTCTAGTTCCTCCAGTTTCCGCCC
GGATGCTTCCAAGGGATATATGGTAGCATTCGCTGGTGCAAAATACGCTGCAAGATCACTCCCAATTATGGTTGCAGACA
GCAATCACATCGTGACAAGCTTCACCCTTGTTCTTGAGTTCCAGAAAGGAAGGCTTGAGAACATGTTCTGGAAGAAAGAC
GGATGCTCGAAGTGTTCTGGAGATTCGAAATTCGTGTGCCTCAACAAAGAAGAATGTGCGATCAAGCCGCAAAACTGCAA
GAACCAAGGAGGACAAGTAGATTGTAGCTTGGGGATCCAATTGGCGTTTTCGGGCACGGATAAGCACTACACCGCGTTGA
ATTCGTGGTATGAGGTTGCAAATCTGAAGCAGTACTCGCTCTATGGCCTCTACTCCAATCTAAAGGACTCACTAACCAAC
CCATTCAAGAACATCTTCTGA