Details for Arabidopsis Locus AT3G11780

Position : Chr3 ( 5`- 3724134 .. 3725593 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11780

Protein [Map View]
MSKFTGFSSLAISYFLLVSTIVAATDVHYCDNNEEYEVKVQGVDITPYPIARGEPATFRISANTDTEISSGKLVIEVSYF
GWHIHSETHDLCDETSCPVAIGDFLVAHSQVLPGYTPPTEKRFNLVSIAYYEFHVEGSYSLKMKMLDGRKKELTCIKFSF
DIGFGSSVADM*

DNA
ATGTCTAAGTTCACGGGATTCTCATCTCTCGCTATCTCTTATTTTCTCTTGGTTTCAACGATTGTTGCAGCCACCGATGT
TCACTACTGCGATAATAACGAAGAGTATGAAGTAAAAGTACAAGGAGTTGATATAACTCCTTATCCTATAGCTAGAGGCG
AGCCAGCTACTTTCAGAATTTCTGCTAACACAGACACTGAGATCTCGAGCGGCAAGTTGGTGATCGAAGTTTCCTACTTT
GGATGGCATATTCATTCTGAGACACATGATCTTTGTGATGAGACAAGTTGTCCTGTGGCCATTGGAGATTTCTTGGTAGC
GCACTCGCAAGTTCTTCCCGGATATACCCCTCCTACTGAGAAGAGGTTTAACTTGGTTTCGATAGCATATTATGAGTTCC
ATGTGGAAGGTTCATACTCACTAAAAATGAAGATGCTTGATGGACGCAAGAAGGAGTTAACTTGCATCAAGTTCTCATTT
GATATTGGATTTGGATCCTCCGTGGCCGACATGTAG