Details for Arabidopsis Locus AT3G11773

Position : Chr3 ( 5`- 3722892 .. 3723733 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11773

Protein [Map View]
MMDMKERMVKKLKLITSLGNLKQAIALHKSNLDHTIFHQIDEKECLTPTTIEVSEDKRLQQNLDELLWAFEEKCVAGGQD
SVASSQQASFRERDVSMDCEYKEEMWRLLGEQVTPPRLFIKCKYIGGADEVVSLNENEKLKKLLEVFSSAKSRQCEMCEN
ERFLICSKCNGRSRVVAEHETWKRCIECNENGLVKCALCT*

DNA
ATGATGGATATGAAGGAGAGAATGGTGAAGAAACTTAAGCTTATTACATCTCTTGGGAACTTGAAGCAGGCGATAGCTCT
CCACAAAAGCAATCTTGATCACACAATCTTTCATCAAATAGATGAGAAAGAGTGTCTTACGCCAACGACAATTGAGGTTT
CTGAGGATAAACGACTTCAACAGAATCTTGATGAGCTTTTGTGGGCTTTTGAAGAGAAATGTGTAGCTGGTGGGCAAGAT
TCTGTTGCTTCTTCACAACAAGCATCATTCCGAGAAAGAGATGTTTCAATGGATTGTGAGTACAAAGAAGAGATGTGGAG
ATTGCTTGGGGAGCAAGTTACACCTCCTAGGCTCTTCATAAAGTGTAAGTACATTGGTGGAGCAGACGAGGTGGTGTCTC
TTAACGAAAACGAGAAGCTCAAGAAGCTTCTAGAAGTGTTTTCATCAGCTAAGTCGCGGCAGTGTGAGATGTGCGAGAAC
GAAAGATTTTTGATATGTTCGAAATGCAATGGGAGGTCGAGAGTTGTTGCAGAGCACGAAACCTGGAAGAGATGCATAGA
GTGTAATGAGAATGGTCTTGTGAAATGTGCTCTTTGTACTTAA