Details for Arabidopsis Locus AT3G11745

Position : Chr3 ( 5`- 3713760 .. 3714579 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11745

Protein [Map View]
MSQPNLLRSVIAQAIHGEKSVVSRRNFSSLRSKYDEREMFAKTNRRRLLAFLVATSLSFHLWEFTKKKNARREEKNEAKK
VQQVDLEELK*

DNA
ATGTCGCAGCCGAATCTTCTAAGATCCGTCATAGCGCAGGCAATTCACGGAGAGAAATCGGTTGTGTCTCGACGCAATTT
CTCTTCTTTGCGTAGTAAATATGATGAGAGAGAAATGTTTGCGAAGACAAATAGACGTCGTTTATTGGCTTTTTTAGTGG
CTACCTCTCTCAGCTTCCATCTCTGGGAATTTACCAAGAAGAAAAATGCTCGGCGTGAAGAAAAGAATGAGGCGAAGAAG
GTGCAGCAGGTGGATCTGGAAGAATTAAAATAA