Details for Arabidopsis Locus AT3G11740

Position : Chr3 ( 5`- 3712379 .. 3713446 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11740

Protein [Map View]
MAIVSPNFCAPYPIELGIVRKVMTLTDGNFAVTDVNGNLLFKVKEPLFSISDKRILLDAYDTPILTLRENKVSLHDRWLV
YRGKSTDQSDLLYTLKRSSMIQIMKPKLDIFLAHNKEMKICDFHVKGSWIDRSCVVYAGKSDAIVAQMHKKHTAQSILIG
KSNFSVTVYPNVDFAFIVSLIVILDDINREDSED*

DNA
ATGGCGATCGTTAGCCCTAATTTCTGTGCACCGTACCCTATCGAGTTGGGAATCGTACGGAAGGTGATGACTTTAACCGA
TGGTAACTTCGCCGTCACGGACGTTAACGGCAATCTCCTTTTCAAAGTCAAGGAACCTTTGTTTAGCATCAGCGACAAAA
GGATTTTATTGGACGCATACGATACTCCAATCTTGACTTTGAGAGAAAATAAGGTGAGCTTGCATGATAGGTGGCTAGTA
TATAGAGGGAAGAGTACAGACCAAAGTGATCTATTATACACATTGAAACGATCTTCAATGATTCAAATAATGAAGCCAAA
ACTAGACATCTTTTTGGCTCATAATAAAGAAATGAAGATTTGCGACTTCCATGTTAAAGGAAGTTGGATCGACCGGTCTT
GTGTCGTCTACGCCGGCAAATCTGATGCCATTGTTGCTCAGATGCACAAGAAACATACGGCACAAAGCATATTAATTGGG
AAGAGTAATTTTTCGGTTACTGTCTATCCGAATGTTGACTTTGCTTTTATAGTTTCTCTCATTGTAATCCTCGATGACAT
TAACCGAGAAGATTCAGAAGACTAG