Details for Arabidopsis Locus AT3G11720

Position : Chr3 ( 5`- 3705865 .. 3708721 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11720

Protein [Map View]
MTTTVNRPGPSKIKYVYSRENEGKYLLIGKNISTFLARLVGYASAAGCLLIQLSMEKKRDVSEYRERLNETLSSPELINE
QTLKTLVRKQLNEECSVDILDQRVAALSSTIEKLRSVSTKDQDLSKSSTEASYGDWKVKHDDKDCRVMYREGLKGSPFHT
LLVEGCTDGTIEDCLCVCWESSFYEKWWPKLTFPSFRVLEAKCLQKFRIDEQICLLRVKAPWPLTDREAVLQFFVFEYFK
DDLVIILLNSIEVESGSVAEVNAVRIDFVGGVAIQKVTPEKSYIRFIAEVDIKLDLVPPSLINFMSRQLLGNGFKLFKKT
IGSVAESDDYKTVLADPLYTHIREALYSSDKTDEICQVNELHSQQGRDCEEKEPKLEADDDMEKENETRDCENESVPCKR
DVPEIEEEECVDDLKEENKSSPSSSSSSSSSSEDEDKNGKTRFCISPEVKQALGTLERVISMVRKSKTDNNNTSTSSEEE
EEEASSSPMQHSGSTQIVSSSKVCIQDPNTELLDEASFAHYHNSNKIAPASPEIDLTTNSEVTRITVSQATNLFCQTTEN
SDDNYKPSGLNGGKSSNLQRKRKPSCFGFRFWRRRT*

DNA
ATGACAACGACAGTTAACCGACCTGGTCCCTCTAAAATAAAATATGTATATTCCCGAGAAAATGAGGGAAAGTATCTTCT
AATCGGGAAAAACATCTCCACGTTCCTTGCCCGTCTCGTAGGTTACGCATCAGCAGCTGGGTGTCTGCTGATTCAATTGA
GTATGGAGAAGAAACGAGATGTTTCTGAGTACAGAGAGAGACTTAATGAGACCTTGTCGTCTCCTGAGCTCATTAATGAG
CAAACTCTTAAAACCCTAGTCAGAAAACAACTCAATGAAGAGTGTAGTGTTGATATATTGGATCAAAGAGTAGCTGCTTT
ATCCAGTACAATTGAGAAGCTTAGGAGTGTATCAACAAAGGATCAAGACTTGTCTAAATCAAGCACCGAGGCATCTTATG
GTGATTGGAAAGTGAAACATGATGATAAAGATTGTCGTGTTATGTACCGTGAAGGACTTAAAGGAAGTCCATTTCATACA
TTGCTCGTTGAAGGTTGCACTGATGGGACTATCGAAGACTGTTTATGTGTATGCTGGGAATCATCATTCTATGAGAAATG
GTGGCCAAAGTTGACATTTCCGTCATTCAGGGTCTTAGAAGCTAAATGCTTGCAAAAGTTTAGGATTGATGAACAGATAT
GTTTACTGAGGGTGAAAGCACCGTGGCCACTGACAGACAGAGAAGCTGTTCTGCAGTTTTTCGTATTCGAATACTTTAAA
GATGATTTAGTCATCATCCTACTTAACTCGATCGAAGTGGAGAGCGGCAGTGTAGCTGAAGTGAATGCGGTGAGGATTGA
CTTCGTAGGCGGAGTTGCGATACAAAAAGTGACTCCAGAGAAGAGTTACATAAGATTTATAGCGGAAGTGGATATAAAGC
TGGACTTGGTTCCTCCATCTCTTATTAATTTTATGTCTAGGCAGCTTCTTGGTAACGGTTTCAAACTTTTCAAGAAGACT
ATTGGTTCGGTGGCTGAATCCGATGATTACAAGACAGTTTTAGCTGATCCATTGTATACTCATATACGTGAAGCTCTGTA
TTCTAGTGATAAAACTGATGAAATCTGCCAAGTAAATGAGCTTCATAGCCAACAAGGAAGAGATTGTGAAGAGAAAGAAC
CCAAGTTGGAAGCTGATGATGATATGGAAAAAGAGAATGAGACTCGAGACTGCGAGAATGAATCTGTACCTTGCAAAAGA
GATGTTCCTGAGATCGAGGAAGAAGAATGTGTTGATGATTTAAAGGAAGAAAACAAAAGTTCTCCTTCTTCTTCTTCTTC
TTCTTCTTCTTCTTCTGAGGATGAAGACAAGAATGGCAAAACACGTTTCTGCATAAGTCCGGAGGTGAAGCAAGCTTTAG
GGACATTAGAGAGAGTAATATCAATGGTTAGAAAATCCAAAACAGATAATAATAATACATCAACCTCTTCGGAGGAAGAA
GAAGAAGAAGCATCATCATCTCCAATGCAGCATTCAGGGAGCACTCAGATTGTTTCTAGTAGCAAAGTTTGTATTCAAGA
TCCTAACACTGAACTTCTCGATGAAGCATCCTTTGCACATTATCACAACAGCAACAAAATAGCTCCTGCATCACCCGAGA
TCGATCTTACAACAAACTCTGAGGTAACAAGGATAACAGTCTCGCAAGCAACAAATCTTTTCTGCCAAACAACAGAGAAT
AGTGACGACAATTACAAACCGAGCGGTTTAAACGGAGGTAAGAGCTCAAATCTGCAGAGGAAACGTAAACCGAGCTGCTT
TGGTTTCAGGTTTTGGAGAAGAAGGACTTGA