Details for Arabidopsis Locus AT3G11700

Position : Chr3 ( 5`- 3698839 .. 3701493 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11700

Protein [Map View]
MDRCIYGCSVITIFFSFFFLLNASALESGHHNITGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITI
FAPRNEALERDLDPDFKRFLLQPGNLKSLQTLLLSHIIPKRVGSNQWPEENSGRVKHVTLGHDQVLHLSKLKGTNGKRLV
NSAVITRPDDLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSATAVSVPAGSPPVLPI
ESAMAPGPSLAPAPAPGPGGAHKHFNGDAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVLAPNDEA
MGKLTTDQLSEPGAPEQIMYYHIIPEYQTEESMYNSVRRFGKVKYETLRFPHKVGAKEADGSVKFGSGDRSAYLFDPDIY
TDGRISVQGIDGVLFPEEKEEETVKKPTGPVKKVVQPRRGKLLEVACSMLGAIGKDSYLSRC*

DNA
ATGGATCGTTGTATCTATGGTTGCTCCGTCATTACTATCTTCTTCTCCTTCTTCTTCCTCCTCAATGCATCCGCTTTAGA
ATCGGGTCACCACAACATAACTGGGTCGGGTCAAATAAACTCAAACTCCGTCCTCGTAGCTCTCCTCGATTCTCGTTACA
CTGAACTCGCCGAGCTAGTTGAGAAGGCTCTTCTTCTCCAAACCCTCGAAGACGCCGTTGGTCGTCACAATATTACTATT
TTCGCCCCACGCAATGAAGCACTCGAGCGTGACCTTGACCCGGATTTTAAACGGTTCTTGCTCCAACCAGGTAACCTCAA
ATCTCTCCAAACGCTTCTCTTGTCTCACATTATCCCCAAACGAGTCGGGTCAAACCAATGGCCTGAGGAGAATTCGGGTC
GGGTCAAACACGTCACGTTAGGGCATGACCAAGTGCTGCATTTGAGTAAACTCAAAGGAACAAATGGAAAGAGATTGGTG
AATTCCGCTGTAATTACCCGACCCGATGATTTAACCCGACCCGACGGGTTGATCCACGGAATCGAACGGCTTTTAATCCC
TCGTTCCGTTCAAGAAGATTTCAACCGACGGAGAAATCTCCGATCAATCTCCGCCGTATTACCCGAAGGAGCTCCGGAAA
TCGACCCGAGAACCAACCGTCTCAAGAAATCTGCCACCGCCGTCTCAGTACCCGCCGGATCTCCACCAGTGCTTCCGATT
GAATCCGCTATGGCTCCAGGTCCATCGCTAGCTCCGGCTCCGGCTCCAGGACCTGGAGGTGCACACAAACATTTCAACGG
CGATGCTCAGGTCAAAGATTTCATCCACACATTGTTACATTACGGTGGATACAACGAAATGGCGGATATTCTCGTGAATC
TGACGTCACTTGCGACGGAGATGGGTCGATTGGTGTCAGAAGGTTACGTCCTCACCGTGTTAGCTCCGAACGATGAAGCT
ATGGGGAAATTAACGACTGATCAGCTTAGCGAGCCCGGAGCTCCGGAGCAAATTATGTATTACCACATTATTCCAGAGTA
TCAGACGGAGGAAAGCATGTATAATTCTGTTAGGAGATTTGGGAAGGTGAAGTATGAAACGCTGCGTTTTCCTCACAAGG
TTGGGGCTAAAGAAGCTGATGGCTCGGTTAAATTCGGTTCTGGTGACCGGTCGGCTTATTTGTTTGATCCGGATATTTAC
ACCGATGGTCGCATTTCGGTTCAGGGGATTGATGGTGTTTTGTTCCCAGAGGAGAAGGAAGAAGAGACGGTTAAGAAACC
GACCGGTCCGGTTAAGAAAGTTGTTCAGCCGAGAAGAGGGAAGTTGCTGGAAGTAGCATGTAGTATGCTTGGAGCTATTG
GGAAGGACTCATATCTAAGCAGATGCTGA