Details for Arabidopsis Locus AT3G11690

Position : Chr3 ( 5`- 3694988 .. 3696478 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11690

Protein [Map View]
MNTTLRYDPRQISRQTKPSDTPSSSPSRSNRRQPLLQRSLSSPSPRASCGGSTPAEFCGGTTASCAAVWCCCPCGLVNLL
VLAIYKVPKGICRRAIRSRRRKQLVKNGILPPLPTDGKNERMQRVFQNSEFAIHPLDSDDVSDDEDDDNFLDLKYIGKSV
ATGFTTEEETDEDDEAVLALEKEMWNRFYGAGFWRSPSQRESVSSPRVSKSLSSSPRQSFTEVYRNRDTTVRGGGGGATV
VAATPRAVRHFD*

DNA
ATGAACACGACGTTACGTTACGATCCGAGACAGATCTCGAGGCAAACGAAACCGTCAGATACACCATCGTCTTCTCCGTC
TCGTAGTAACCGGAGACAGCCTTTGCTTCAGAGAAGTCTCTCTTCTCCGTCACCACGAGCTTCTTGCGGCGGATCTACTC
CCGCCGAGTTTTGCGGTGGTACGACGGCGAGTTGCGCCGCCGTGTGGTGTTGTTGTCCCTGCGGACTCGTTAACCTACTC
GTTCTCGCGATCTACAAAGTTCCTAAAGGAATCTGCCGTCGCGCTATCAGAAGTCGCCGCCGTAAACAACTCGTGAAGAA
CGGAATCCTTCCGCCGCTTCCGACGGACGGGAAAAACGAGCGGATGCAGAGAGTTTTTCAGAATTCTGAATTCGCGATTC
ATCCGTTGGATAGCGACGATGTGTCTGACGACGAAGATGATGATAATTTCTTGGATCTGAAGTATATCGGAAAATCGGTA
GCGACGGGGTTTACGACGGAGGAGGAGACTGATGAAGATGATGAGGCGGTGTTAGCATTAGAGAAAGAGATGTGGAATAG
GTTTTACGGAGCTGGATTTTGGCGAAGTCCGTCACAGAGAGAATCAGTTTCGTCTCCGAGAGTTTCCAAGTCTCTTTCGT
CATCGCCGAGACAATCGTTTACTGAAGTATACCGGAATAGGGATACAACGGTTAGAGGAGGAGGAGGAGGAGCTACGGTG
GTGGCGGCGACACCAAGAGCCGTTAGGCATTTTGATTAG