Details for Arabidopsis Locus AT3G11680

Position : Chr3 ( 5`- 3686995 .. 3689329 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11680

Protein [Map View]
MDLNAQEKKAGFFQRLQDFPSKLKDDVTKRVKNVQKFAKDDPRRIIHSMKVGVALTLVSLLYYVRPLYISFGVTGMWAIL
TVVVVFEFTVGGTLSKGLNRGFATLIAGALGVGAVHLARFFGHQGEPIVLGILVFSLGAAATFSRFFPRIKQRYDYGALI
FILTFSFVAISGYRTDEILIMAYQRLSTILIGGTICILVSIFICPVWAGEDLHKMIANNINKLAKYLEGFEGEYFQPEKI
SKETSSCVREYKSILTSKSTEDSLANLARWEPGHGRFRLRHPWKKYLKIAGLVRQCAVHLEILNGYVLSNDKAPQEFESK
IQEPITTMSREVGEALKAIAKSIKTMRNDSACVNAHIDNSKKAIKNLKIALKSSYPETYKDLLEIIPGVTMASILIEVVN
CVEKIYEAVEEFSGLAHFKETLDSKLSAEIGQHQLLHRGCVKPVLDGDNEKEDNSSCHVLITVHDEGYLPTATAKNVLGA
EKTRVDIV*

DNA
ATGGATTTGAATGCTCAAGAGAAGAAAGCAGGGTTCTTTCAAAGGCTTCAGGATTTCCCTAGCAAGCTCAAAGACGATGT
CACCAAACGCGTAAAGAATGTGCAAAAGTTTGCGAAAGATGATCCAAGACGGATCATCCACTCCATGAAAGTGGGGGTTG
CTCTCACATTAGTGTCATTGTTGTACTATGTGCGACCACTCTACATCAGCTTTGGGGTCACGGGTATGTGGGCGATACTT
ACCGTAGTCGTGGTCTTCGAATTCACTGTTGGTGGAACACTTTCCAAAGGTTTAAACAGAGGGTTTGCAACATTAATAGC
AGGAGCCTTAGGGGTTGGGGCAGTACACCTTGCTCGTTTCTTTGGGCATCAAGGAGAGCCCATAGTTCTTGGGATCTTAG
TGTTCTCACTAGGCGCAGCTGCAACATTTTCGCGGTTTTTCCCACGGATTAAACAGAGATATGACTATGGTGCTCTGATA
TTCATACTCACATTTAGTTTCGTTGCGATTTCGGGTTACCGTACAGATGAAATATTGATTATGGCATATCAAAGACTATC
GACTATTCTTATCGGTGGCACGATCTGCATCCTTGTGTCGATTTTCATTTGTCCTGTATGGGCTGGCGAAGATCTTCACA
AGATGATTGCTAACAACATTAACAAACTTGCTAAGTACCTAGAAGGATTCGAGGGTGAATATTTTCAACCGGAGAAGATT
TCAAAGGAGACAAGCTCGTGTGTTCGAGAATACAAAAGCATTCTAACATCAAAAAGCACTGAAGATAGTTTGGCGAATCT
TGCAAGATGGGAACCAGGGCATGGACGTTTCAGGTTACGGCACCCGTGGAAAAAGTACTTGAAAATTGCAGGACTCGTTC
GCCAATGTGCCGTCCATTTAGAAATCCTCAATGGCTACGTTCTTTCAAACGATAAGGCACCACAAGAATTCGAAAGTAAG
ATTCAAGAGCCAATCACGACTATGAGCAGAGAAGTTGGTGAAGCCCTAAAAGCCATAGCCAAATCTATTAAAACAATGAG
GAACGATAGTGCTTGTGTGAACGCACACATTGACAACTCCAAAAAGGCCATTAAAAACTTAAAGATTGCACTCAAATCTT
CTTATCCAGAGACATATAAAGATCTTTTGGAGATCATTCCCGGAGTCACAATGGCATCAATCCTGATCGAGGTCGTGAAT
TGCGTCGAGAAGATCTACGAGGCTGTGGAAGAATTCTCTGGTCTTGCACATTTCAAAGAGACTTTGGATTCAAAACTATC
AGCGGAGATAGGACAACATCAATTACTCCACAGGGGATGTGTAAAGCCGGTTCTAGATGGCGACAACGAGAAAGAAGACA
ATAGCTCATGTCATGTTCTTATCACTGTCCATGATGAAGGATATCTACCGACGGCCACCGCGAAGAACGTTTTGGGAGCA
GAGAAGACTAGAGTAGATATTGTGTGA