Details for Arabidopsis Locus AT3G11670

Position : Chr3 ( 5`- 3680893 .. 3684558 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11670

Protein [Map View]
MVKETLIPPSSTSMTTGTSSSSSLSMTLSSTNALSFLSKGWREVWDSADADLQLMRDRANSVKNLASTFDREIENFLNNS
ARSAFPVGSPSASSFSNEIGIMKKLQPKISEFRRVYSAPEISRKVMERWGPARAKLGMDLSAIKKAIVSEMELDERQGVL
EMSRLRRRRNSDRVRFTEFFAEAERDGEAYFGDWEPIRSLKSRFKEFEKRSSLEILSGFKNSEFVEKLKTSFKSIYKETD
EAKDVPPLDVPELLACLVRQSEPFLDQIGVRKDTCDRIVESLCKCKSQQLWRLPSAQASDLIENDNHGVDLDMRIASVLQ
STGHHYDGGFWTDFVKPETPENKRHVAIVTTASLPWMTGTAVNPLFRAAYLAKAAKQSVTLVVPWLCESDQELVYPNNLT
FSSPEEQESYIRKWLEERIGFKADFKISFYPGKFSKERRSIFPAGDTSQFISSKDADIAILEEPEHLNWYYHGKRWTDKF
NHVVGIVHTNYLEYIKREKNGALQAFFVNHVNNWVTRAYCDKVLRLSAATQDLPKSVVCNVHGVNPKFLMIGEKIAEERS
RGEQAFSKGAYFLGKMVWAKGYRELIDLMAKHKSELGSFNLDVYGNGEDAVEVQRAAKKHDLNLNFLKGRDHADDALHKY
KVFINPSISDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYKTSEDFVSKVQEAMTKEPLPLTPEQMYNLSWEAA
TQRFMEYSDLDKILNNGEGGRKMRKSRSVPSFNEVVDGGLAFSHYVLTGNDFLRLCTGATPRTKDYDNQHCKDLNLVPPH
VHKPIFGW*

DNA
ATGGTAAAGGAAACTCTAATTCCTCCGTCATCTACGTCAATGACGACCGGAACATCTTCTTCTTCGTCTCTTTCAATGAC
GTTATCCTCAACAAACGCGTTATCGTTTTTGTCGAAAGGATGGAGAGAGGTATGGGATTCAGCAGATGCGGATTTGCAGC
TGATGCGAGACAGAGCTAACTCTGTTAAGAATCTAGCATCAACGTTCGATAGAGAGATCGAGAATTTCCTCAATAACTCG
GCGAGGTCTGCGTTTCCCGTTGGTTCACCATCGGCGTCGTCTTTCTCAAATGAAATTGGTATCATGAAGAAGCTTCAGCC
GAAGATTTCGGAGTTTCGTAGGGTTTATTCGGCGCCGGAGATTAGTCGCAAGGTTATGGAGAGATGGGGACCTGCGAGAG
CGAAGCTTGGAATGGATCTATCGGCGATTAAGAAGGCGATTGTGTCTGAGATGGAATTGGATGAGCGTCAGGGAGTTTTG
GAGATGAGTAGATTGAGGAGACGGCGTAATAGTGATAGGGTTAGGTTTACGGAGTTTTTCGCGGAGGCTGAGAGAGATGG
AGAAGCTTATTTCGGTGATTGGGAACCGATTAGGTCTTTGAAGAGTAGATTTAAAGAGTTTGAGAAACGAAGCTCGTTAG
AAATATTGAGTGGATTCAAGAACAGTGAATTTGTTGAGAAGCTCAAAACCAGCTTTAAATCAATTTACAAAGAAACTGAT
GAGGCTAAGGATGTCCCTCCGTTGGATGTACCTGAACTGTTGGCATGTTTGGTTAGACAATCTGAACCTTTTCTTGATCA
GATTGGTGTTAGAAAGGATACATGTGACCGAATAGTAGAAAGCCTTTGCAAATGCAAGAGCCAACAACTTTGGCGTCTGC
CATCTGCACAAGCATCCGATTTAATTGAAAATGATAACCATGGAGTTGATTTGGATATGAGGATAGCCAGTGTTCTTCAA
AGCACAGGACACCATTATGATGGTGGGTTTTGGACTGATTTTGTGAAGCCTGAGACACCGGAAAACAAAAGGCATGTGGC
AATTGTTACAACAGCTAGTCTTCCTTGGATGACCGGAACAGCTGTAAATCCGCTATTCAGAGCGGCGTATTTGGCAAAAG
CTGCAAAACAGAGTGTTACTCTCGTGGTTCCTTGGCTCTGCGAATCTGATCAAGAACTAGTGTATCCAAACAATCTCACC
TTCAGCTCACCTGAAGAACAAGAGAGTTATATACGTAAATGGTTGGAGGAAAGGATTGGTTTCAAGGCTGATTTTAAAAT
CTCCTTTTACCCAGGAAAGTTTTCAAAAGAAAGGCGCAGCATATTTCCTGCTGGTGACACTTCTCAATTTATATCGTCAA
AAGATGCTGACATTGCTATACTTGAAGAACCTGAACATCTCAACTGGTATTATCACGGCAAGCGTTGGACTGATAAATTC
AACCATGTTGTTGGAATTGTCCACACAAACTACTTAGAGTACATCAAGAGGGAGAAGAATGGAGCTCTTCAAGCATTTTT
TGTGAACCATGTAAACAATTGGGTCACACGAGCGTATTGTGACAAGGTTCTTCGCCTCTCTGCGGCAACACAAGATTTAC
CAAAGTCTGTTGTATGCAATGTCCATGGTGTCAATCCCAAGTTCCTTATGATTGGGGAGAAAATTGCTGAAGAGAGATCC
CGTGGTGAACAAGCTTTCTCAAAAGGTGCATACTTCTTAGGAAAAATGGTGTGGGCTAAAGGATACAGAGAACTAATAGA
TCTGATGGCTAAACACAAAAGCGAACTTGGGAGCTTCAATCTAGATGTATATGGGAACGGTGAAGATGCAGTCGAGGTCC
AACGTGCAGCAAAGAAACATGACTTGAATCTCAATTTCCTCAAAGGAAGGGACCACGCTGACGATGCTCTTCACAAGTAC
AAAGTGTTCATAAACCCCAGCATCAGCGATGTTCTATGCACAGCAACCGCAGAAGCACTAGCCATGGGGAAGTTTGTGGT
GTGTGCAGATCACCCTTCAAACGAATTCTTTAGATCATTCCCGAACTGCTTAACTTACAAAACATCCGAAGACTTTGTGT
CCAAAGTGCAAGAAGCAATGACGAAAGAGCCACTACCTCTCACTCCTGAACAAATGTACAATCTCTCTTGGGAAGCAGCA
ACACAGAGGTTCATGGAGTATTCAGATCTCGATAAGATCTTAAACAATGGAGAGGGAGGAAGGAAGATGCGAAAATCAAG
ATCGGTTCCGAGCTTTAACGAGGTGGTCGATGGAGGATTGGCATTCTCACACTATGTTCTAACAGGGAACGATTTCTTGA
GACTATGCACTGGAGCAACACCAAGAACAAAAGACTATGATAATCAACATTGCAAGGATCTGAATCTCGTACCACCTCAC
GTTCACAAGCCAATCTTCGGCTGGTAG