Details for Arabidopsis Locus AT3G11650

Position : Chr3 ( 5`- 3676146 .. 3677037 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11650

Protein [Map View]
MGSKQPYLNGAYYGPSIPPPPKAHRSYNSPGFGCCCFSCLGSCLRCCGCCILSLICNILIAVAVILGVAALILWLIFRPN
AVKFYVADANLNRFSFDPNNNLHYSLDLNFTIRNPNQRVGVYYDEFSVSGYYGDQRFGSANVSSFYQGHKNTTVILTKIE
GQNLVVLGDGARTDLKDDEKSGIYRINAKLRLSVRFKFWFIKSWKLKPKIKCDDLKIPLGSSNSTGGFKFQPVQCDFDLS
*

DNA
ATGGGGTCCAAACAACCATACCTAAACGGCGCGTACTACGGACCATCAATTCCACCACCGCCTAAGGCTCACCGCAGCTA
TAACTCACCTGGATTCGGATGCTGTTGCTTCAGCTGCCTCGGAAGCTGTCTACGTTGCTGCGGTTGCTGCATCTTAAGCC
TGATCTGCAACATCCTCATAGCTGTAGCCGTAATCCTCGGAGTCGCCGCTCTTATCCTCTGGCTCATCTTCCGTCCAAAC
GCCGTCAAATTCTACGTCGCCGACGCTAATCTGAACCGATTCAGCTTCGATCCAAACAACAACCTCCATTACAGTCTCGA
TCTCAATTTCACAATCCGTAACCCTAATCAACGAGTCGGAGTCTACTACGATGAGTTCTCGGTTAGTGGCTATTACGGAG
ATCAGAGATTCGGATCTGCGAACGTTTCGTCGTTTTATCAAGGGCATAAGAATACGACGGTGATTTTAACCAAAATTGAA
GGACAGAATCTGGTGGTGCTCGGCGACGGAGCGAGAACAGATCTAAAAGATGATGAGAAATCTGGGATTTATCGGATTAA
TGCGAAATTGAGGCTAAGTGTTAGGTTTAAGTTTTGGTTTATAAAGTCGTGGAAGCTTAAACCAAAGATTAAGTGTGATG
ATCTTAAGATTCCTCTTGGTTCCTCTAATTCTACAGGAGGGTTTAAGTTTCAACCGGTGCAGTGTGACTTTGACTTATCT
TAG