Details for Arabidopsis Locus AT3G11620

Position : Chr3 ( 5`- 3669319 .. 3672034 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11620

Protein [Map View]
METQNKLMNETKRHVKSRLCRVSGSMTEMMEIQAENPTFHVLFIPGNPGVVSFYKDFLESLYEFLGGNASVIAIGQISHT
SKDWESGRLFSFQEQIDHKIDFIRQELESVKVPIILVGHSIGSYISLELLKKFSDKVVYCIGLYPFLTLNQQSTKQSLIG
KLAASSVLSATASFLIASLRLLPMSAARLLVSKSIGASWSDTAVQATCTHLRQYHTMRNVLFMAKSEFRELAAEPDWDFM
RENQSKLAFLFGIDDHWGPLQLFEEISKQAPHTSLSIEREGHTHGFCCTVAGSAWVAQHVATLIKNRFSQLQ*

DNA
ATGGAGACTCAAAACAAATTGATGAATGAAACTAAAAGACATGTTAAATCCAGATTGTGCAGAGTTTCTGGTTCGATGAC
GGAGATGATGGAAATTCAAGCTGAGAATCCCACATTCCATGTATTGTTTATTCCGGGAAATCCAGGAGTTGTGTCATTTT
ACAAGGACTTTTTGGAATCTTTATACGAGTTTCTTGGTGGAAATGCTTCTGTAATTGCTATTGGGCAAATATCTCACACG
AGCAAGGACTGGGAGTCTGGGAGGCTATTTTCATTTCAAGAACAAATTGATCATAAGATTGATTTTATCAGACAGGAGTT
GGAGAGTGTGAAAGTTCCAATAATATTGGTTGGGCATTCTATTGGGTCTTATATATCCCTTGAGTTATTGAAGAAATTCT
CGGACAAGGTGGTATATTGCATTGGCCTATATCCATTTTTGACTTTGAACCAACAATCAACAAAGCAATCATTAATTGGC
AAACTTGCAGCGTCTTCTGTTCTGTCGGCTACAGCAAGTTTTCTGATTGCATCGCTGAGACTTTTACCTATGTCAGCTGC
ACGGCTGCTTGTATCTAAATCCATTGGAGCTTCATGGTCTGATACTGCTGTTCAAGCTACCTGCACTCACTTGAGGCAGT
ATCACACCATGCGCAATGTTCTCTTCATGGCAAAGTCAGAGTTTAGAGAGCTTGCAGCAGAGCCAGATTGGGATTTCATG
AGAGAAAACCAGAGCAAGCTTGCATTTTTATTTGGCATTGATGATCATTGGGGTCCACTGCAACTCTTTGAAGAGATTTC
AAAGCAAGCTCCGCATACTTCCTTATCTATCGAGAGGGAAGGTCACACGCACGGATTCTGCTGCACGGTGGCTGGCTCGG
CATGGGTTGCGCAGCACGTAGCCACTCTAATCAAGAACCGGTTTTCACAGCTCCAGTAA