Details for Arabidopsis Locus AT3G11591

Position : Chr3 ( 5`- 3663544 .. 3663986 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11591

Protein [Map View]
MVFFMSYPPTRRQLVVSVGFFAAGVSLFVAGAYLSLANISPQQARVKARNDFVKDRIRKWLDD*

DNA
ATGGTGTTTTTTATGTCGTATCCGCCGACACGGCGGCAGTTAGTAGTGTCGGTGGGTTTTTTCGCGGCGGGCGTTTCTCT
CTTCGTCGCCGGAGCGTATCTCTCACTCGCCAACATCTCACCGCAACAAGCTCGCGTCAAAGCTCGTAATGATTTCGTCA
AGGATCGAATCAGGAAATGGCTCGACGATTAG