Details for Arabidopsis Locus AT3G11550

Position : Chr3 ( 5`- 3638195 .. 3639197 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11550

Protein [Map View]
MKNESTFIDVPAESSSAMKGKAPLIGVARDHTTSGSGGYNRGLAIFDFLLRLAAIVAALAAAATMGTSDETLPFFTQFLQ
FEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPLATAPRLLLLVLDTGVLALNTAAASSAAAISYLAHSGNQNT
NWLPICQQFGDFCQKSSGAVVSAFVSVVFFTILVVISGVALKRH*

DNA
ATGAAGAACGAATCTACCTTCATTGATGTCCCTGCAGAATCCAGCTCAGCCATGAAAGGCAAAGCTCCTCTAATCGGTGT
AGCAAGAGACCACACTACTAGTGGCTCAGGTGGATACAACAGAGGACTCGCCATCTTTGACTTCCTCCTCCGTTTAGCTG
CCATTGTTGCAGCTTTAGCTGCTGCCGCCACGATGGGAACAAGCGACGAGACTCTTCCCTTCTTCACACAGTTCTTACAG
TTCGAAGCTAGCTACGACGATCTACCAACTTTCCAGTTCTTTGTGATTGCCATGGCCCTTGTAGGAGGATATCTCGTTCT
GTCTCTTCCAATCTCCGTCGTCACAATCCTTCGCCCTCTCGCCACCGCCCCAAGACTCCTCTTGCTCGTTCTTGACACTG
GGGTCCTGGCGTTGAACACGGCGGCTGCATCATCGGCGGCAGCAATATCATATCTAGCACACAGTGGTAACCAGAACACG
AACTGGCTCCCCATTTGCCAACAGTTTGGAGACTTCTGTCAAAAATCCAGCGGAGCTGTTGTCTCTGCCTTTGTCTCCGT
CGTATTCTTCACCATCCTCGTTGTCATCTCCGGCGTCGCTCTGAAAAGACACTAA