Details for Arabidopsis Locus AT3G11530

Position : Chr3 ( 5`- 3628594 .. 3630536 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11530

Protein [Map View]
MFSSSILLQILACAIYGNWWPMLSALMYVVVPMPCMFFGGGSTQFLISRDGGGWIDAAKFLTGASTVGSLAIPIILRHAQ
MIETGAMLIEFTSFFIFICTVMCFHRASLDDDW*

DNA
ATGTTTTCATCTAGTATCCTCCTACAGATCCTGGCATGCGCGATATATGGTAACTGGTGGCCAATGCTATCAGCACTCAT
GTATGTAGTGGTGCCTATGCCTTGTATGTTCTTTGGAGGAGGCTCAACCCAATTCCTTATTAGTCGGGACGGTGGAGGGT
GGATAGACGCAGCGAAGTTCTTGACCGGAGCATCGACCGTGGGAAGCCTTGCTATCCCAATCATCTTAAGGCACGCACAG
ATGATCGAGACAGGTGCAATGCTCATAGAGTTCACATCATTCTTCATATTCATTTGCACTGTCATGTGTTTTCACCGGGC
TAGTCTCGATGATGACTGGTAA