Details for Arabidopsis Locus AT3G11500

Position : Chr3 ( 5`- 3621409 .. 3622606 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11500

Protein [Map View]
MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVEVNGDDKTDIGMVVIRGNSIVTVEALEPVGRS*

DNA
ATGAGTCGATCAGGTCAGCCTCCAGATCTCAAGAAGTACATGGACAAGAAACTCCAAATTAAGCTTAATGCCAACAGAAT
GGTTGTTGGAACTCTCCGTGGCTTTGATCAGTTCATGAATCTTGTTGTGGATAACACTGTTGAAGTCAATGGTGATGACA
AAACTGACATTGGGATGGTGGTGATAAGAGGAAACAGCATTGTTACTGTTGAAGCTCTCGAACCAGTTGGAAGATCTTAG