Details for Arabidopsis Locus AT3G11450

Position : Chr3 ( 5`- 3605217 .. 3608086 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11450

Protein [Map View]
MPSRRSESAIRLITYSEELVDGKPFFAFSNCLPVKALNREPAGHAFHSAALKLHGCAEEPTDDEGGDKKVGDDKEKEYVP
SFNSYANKGKKKSGTQQQDHYALLGLSNLRYLATEDQIRKSYREAALKHHPDKLASLLLLEETEEAKEAKKDEIESRFKA
IQEAYEVLMDPTRRRIFDSTDEFDDEVPSDCLPQDFFKVFGPAFKRNARWSVNQRIPDLGDENTPLKDVDKFYNFWYAFK
SWREFPDEEEHDLEQADSREERRWMEKENAKKTVKARKEEHARIRTLVDNAYRKDPRIVKRKEEEKAEKQQKKDAKIQAK
KKQEEDAAIAAEEEKRRKEEEEKRAAESAQQQKKTKEREKKLLRKERNRLRTLSAPLVAQRLLDISEEDIENLCMSLNTE
QLQNLCDKMGNKEGLELAKVIKDGCNSSRNDEAESKEKVSKKTNGGTEPTTRVSQLDSSTQKKQPWSKEEIDMLRKGMIK
YPKGTSRRWEVISEYIGTGRSVEEILKATKTVLLQKPDSAKAFDSFLEKRKPSASITSPLSTREELGESLPTMTTTTNAK
PSKETVVGKSSSSQSSDNNGEVGGSSDADSWSTVQERALVQALKTFPKETSQRWERVAAAVPGKTMNQCKKKFAELKEII
RNKKTGV*

DNA
ATGCCGAGCCGGAGAAGTGAGTCTGCTATTAGGCTAATTACGTACTCTGAGGAGCTTGTGGATGGAAAACCGTTCTTTGC
TTTTTCCAATTGTCTTCCTGTGAAGGCTTTAAACCGTGAACCTGCTGGTCATGCCTTCCATTCTGCTGCGCTTAAACTGC
ATGGTTGTGCAGAAGAACCCACAGACGATGAAGGTGGTGATAAGAAAGTGGGAGATGATAAAGAGAAGGAATATGTTCCT
TCATTCAACTCGTATGCCAACAAAGGAAAGAAGAAGTCTGGTACCCAGCAACAAGACCACTATGCGTTGTTGGGTTTGAG
CAATCTAAGATATCTTGCGACGGAAGATCAGATTAGGAAAAGTTATCGTGAAGCTGCATTGAAGCATCATCCTGATAAAC
TCGCTAGTCTCCTTCTGTTAGAGGAAACAGAAGAAGCCAAGGAGGCAAAAAAAGATGAGATTGAATCTCGCTTCAAAGCG
ATTCAAGAAGCATATGAGGTATTGATGGACCCAACTAGGAGAAGAATTTTTGACTCCACTGATGAGTTTGATGACGAGGT
CCCATCGGATTGCTTGCCGCAAGACTTTTTCAAGGTGTTTGGTCCAGCGTTTAAGAGAAATGCTAGGTGGTCAGTGAATC
AGCGTATTCCAGATTTGGGAGATGAAAACACACCACTTAAAGATGTTGATAAGTTCTACAACTTTTGGTACGCTTTCAAG
AGTTGGAGGGAATTTCCTGATGAAGAGGAGCATGATCTTGAACAAGCAGATTCCCGTGAAGAACGTAGGTGGATGGAAAA
GGAGAATGCAAAAAAAACTGTGAAGGCTAGAAAGGAGGAGCATGCTCGAATCAGGACTCTTGTTGACAATGCGTATAGAA
AAGACCCGAGAATTGTGAAAAGAAAAGAGGAAGAAAAGGCTGAGAAGCAACAGAAAAAAGATGCAAAAATTCAGGCCAAG
AAGAAGCAGGAAGAGGACGCTGCTATTGCTGCTGAAGAAGAGAAAAGGCGAAAAGAAGAAGAAGAAAAGCGAGCAGCAGA
ATCTGCACAACAACAAAAGAAAACTAAGGAAAGAGAGAAGAAGCTCTTACGCAAAGAACGAAATCGTCTTAGAACTCTCT
CAGCTCCTCTCGTGGCTCAGCGTCTGCTTGACATCTCTGAGGAAGATATAGAGAATCTATGCATGTCACTTAACACCGAG
CAGTTGCAGAATCTATGTGATAAAATGGGAAACAAAGAAGGACTAGAATTGGCAAAGGTGATCAAAGATGGATGCAACAG
TAGTAGAAATGATGAAGCCGAATCTAAAGAAAAAGTAAGTAAGAAGACCAACGGTGGCACAGAGCCTACAACCCGAGTTT
CACAGTTAGATAGTAGCACTCAGAAGAAACAACCATGGAGCAAGGAAGAGATTGATATGCTGAGAAAAGGAATGATAAAA
TATCCAAAGGGGACATCGCGGAGATGGGAAGTTATTTCAGAGTACATTGGTACAGGAAGATCTGTAGAGGAAATTCTGAA
AGCAACTAAAACAGTTCTCCTGCAAAAACCAGATTCAGCTAAAGCATTCGATTCTTTCCTCGAGAAGAGGAAACCCTCTG
CTTCAATCACATCCCCTCTCTCCACAAGAGAGGAGCTCGGAGAATCTCTACCCACAATGACGACCACAACAAATGCAAAG
CCCTCTAAAGAGACTGTTGTGGGGAAAAGCTCGAGCAGTCAAAGCTCAGACAACAATGGTGAAGTAGGTGGAAGTTCAGA
CGCAGATAGTTGGTCGACTGTGCAAGAAAGAGCTTTGGTTCAAGCTTTAAAGACATTCCCGAAAGAGACAAGCCAAAGAT
GGGAGAGAGTAGCTGCAGCTGTCCCTGGTAAAACGATGAACCAATGCAAGAAGAAGTTTGCAGAGCTTAAGGAAATCATT
AGAAACAAGAAAACCGGAGTATGA