Details for Arabidopsis Locus AT3G11410

Position : Chr3 ( 5`- 3583883 .. 3585790 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11410

Protein [Map View]
MAGICCGVVGETEPAAPVDSTSRASLRRRLDLLPSIKIVADSAVAPPLENCRKRQKRETVVLSTLPGNLDLDSNVRSENK
KARSAVTNSNSVTEAESFFSDVPKIGTTSVCGRRRDMEDAVSIHPSFLQRNSENHHFYGVFDGHGCSHVAEKCRERLHDI
VKKEVEVMASDEWTETMVKSFQKMDKEVSQRECNLVVNGATRSMKNSCRCELQSPQCDAVGSTAVVSVVTPEKIIVSNCG
DSRAVLCRNGVAIPLSVDHKPDRPDELIRIQQAGGRVIYWDGARVLGVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDEDE
CLILASDGLWDVVPNETACGVARMCLRGAGAGDDSDAAHNACSDAALLLTKLALARQSSDNVSVVVVDLRKRRNNQASS*

DNA
ATGGCTGGGATTTGTTGCGGTGTTGTTGGAGAGACTGAACCGGCGGCACCGGTTGATTCAACTTCTCGAGCTTCTCTTAG
ACGGAGGTTAGATCTACTTCCGTCGATCAAAATTGTTGCTGACTCCGCCGTTGCTCCTCCGCTTGAAAACTGCCGTAAAC
GGCAGAAGCGTGAGACAGTAGTGCTCTCGACGTTACCGGGAAATCTAGATCTGGATTCGAATGTGAGGAGTGAGAATAAG
AAGGCTAGATCAGCGGTTACGAATTCAAATTCTGTTACGGAAGCAGAGAGTTTCTTTTCCGATGTACCTAAGATCGGTAC
GACGTCGGTTTGTGGTAGAAGACGAGACATGGAAGACGCTGTCTCGATTCATCCTTCGTTTCTTCAACGGAACTCTGAGA
ATCATCATTTCTACGGTGTCTTTGACGGCCATGGCTGCTCTCATGTTGCGGAGAAGTGCAGAGAACGGTTGCATGATATA
GTGAAGAAGGAAGTTGAAGTTATGGCTTCCGACGAGTGGACAGAGACGATGGTTAAGAGTTTTCAAAAAATGGATAAAGA
AGTTAGCCAACGAGAGTGTAACTTAGTTGTTAATGGTGCTACTCGGAGTATGAAAAATTCTTGTAGATGTGAATTGCAGT
CTCCTCAGTGTGACGCCGTCGGATCCACCGCTGTTGTATCGGTTGTCACGCCGGAGAAGATCATTGTTTCTAATTGCGGT
GATTCACGGGCTGTGCTTTGTCGTAACGGTGTAGCCATTCCTCTCTCCGTAGATCACAAGCCGGATCGACCCGATGAATT
GATTCGGATCCAACAAGCTGGTGGGCGAGTTATATATTGGGATGGAGCTAGGGTTCTTGGAGTTCTTGCCATGTCTAGAG
CAATTGGTGATAATTACTTGAAACCGTATGTGATTCCGGATCCGGAGGTAACAGTGACGGATCGAACTGATGAGGATGAG
TGTTTGATCTTGGCGAGTGATGGACTATGGGATGTTGTACCAAACGAGACGGCGTGTGGCGTGGCTCGCATGTGCCTTCG
AGGTGCTGGTGCGGGTGACGACTCAGATGCGGCGCACAATGCGTGCTCCGATGCGGCGTTGCTCTTAACAAAGTTGGCTC
TAGCAAGACAGAGCTCCGATAACGTGAGCGTCGTTGTGGTTGACTTGAGGAAGAGGAGGAATAATCAAGCGTCGTCTTAA