Details for Arabidopsis Locus AT3G11400

Position : Chr3 ( 5`- 3578388 .. 3580569 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11400

Protein [Map View]
MTIDSQQKTSKFRWGEMDEDEDLDFLLPPKQVIGPDENGLKTTIEYKFNDEENKVKITTRTRVRKLASARLNKRAMERRN
WPKFGDAANEEAGSHLTMVSTEEILLERPRAPGDQLANHMLASIPEYELKCALTFVAANCTKADESKATGDGLSQLGKGG
AVLMVCRICHKKGDHWTSKCPYKDLAAPTDVFIDKPPTGESSTMSAAPGTGKAAYVPPSMRAGADRSAVGSDMRRRNDEN
SVRVTNLSEDTREPDLMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWATPRP
T*

DNA
ATGACGATCGATTCGCAGCAAAAAACGAGCAAATTCAGATGGGGGGAAATGGACGAAGACGAAGATCTGGATTTCTTGCT
CCCTCCCAAGCAGGTGATTGGTCCAGATGAGAATGGTTTGAAGACGACGATCGAGTACAAATTCAACGATGAAGAAAATA
AGGTTAAGATAACGACTAGGACACGTGTCCGCAAGCTAGCTTCTGCTCGACTCAACAAACGAGCCATGGAGAGGAGGAAC
TGGCCTAAGTTCGGAGACGCAGCCAATGAGGAAGCTGGTAGCCATCTCACTATGGTTTCTACCGAAGAGATCCTTCTCGA
ACGACCCCGAGCTCCTGGTGACCAATTAGCGAATCACATGTTAGCCTCCATTCCTGAGTACGAGCTGAAATGTGCTCTCA
CTTTTGTGGCTGCTAACTGTACCAAAGCGGATGAATCAAAGGCAACAGGAGATGGCTTGTCTCAGCTGGGTAAAGGTGGT
GCAGTTCTCATGGTGTGCAGGATATGCCACAAGAAAGGAGATCACTGGACATCAAAATGTCCATACAAGGATCTAGCTGC
ACCAACCGATGTCTTCATTGACAAGCCACCCACAGGGGAATCATCTACCATGTCTGCTGCACCTGGAACTGGCAAGGCCG
CGTATGTCCCGCCTAGCATGAGAGCAGGTGCAGACAGAAGCGCTGTGGGTTCAGACATGAGGAGGAGGAACGATGAGAAC
TCTGTGCGTGTAACCAATCTGTCCGAGGATACCCGTGAACCTGACTTGATGGAGCTGTTCCACCCGTTTGGAGCTGTCAC
ACGTGTCTATGTGGCCATTGATCAGAAAACTGGAGTGAGCAGAGGATTTGGTTTCGTCAATTTCGTGAGCAGAGAAGACG
CTCAAAGAGCAATCAACAAATTGAATGGTTATGGTTATGATAACCTCATCCTCAGGGTTGAATGGGCAACTCCAAGACCA
ACCTAG