Details for Arabidopsis Locus AT3G11397

Position : Chr3 ( 5`- 3576017 .. 3578082 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11397

Protein [Map View]
MDWDSVAAEDVIEALREVEWSASPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFILFVFVLGLALITRPLAILGA
ALTALSLAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPPHMPVIRGRSATRKTVYICGQPRLVFVLLGLTASFVLWFTS
CGLLWVLYALTTALLMILLHASLRTPNLKARLNTFREEFRAVWRNYSEL*

DNA
ATGGATTGGGACAGCGTTGCTGCTGAGGATGTGATTGAGGCGTTAAGAGAGGTTGAATGGTCGGCGAGTCCTCGTTCCTT
GGCCGAGTTCTTCTCCAGATTCGCGTTTCCTCGCTCTTTCTCTAAATGGATGAGCCGTCTCAAATGCAATCTCTACTACT
ATAGGACGAATTACTTCATCCTCTTCGTTTTCGTTCTGGGTCTTGCACTTATCACTCGACCTCTGGCAATTCTTGGTGCT
GCTCTTACAGCTTTAAGCTTAGCTTTCCTAAACGACAGTTTTGCAGCTACTTTTAATGAGAAGATGATCCGGACCATTAG
GCATTTCTCGCCACATTTAGCTGCAAAGATGAGGCCTCCCCACATGCCTGTCATTCGTGGGCGATCTGCAACTAGAAAGA
CAGTCTACATTTGTGGCCAACCACGTTTGGTATTCGTCTTACTTGGCTTAACCGCCAGTTTTGTCCTGTGGTTTACTTCA
TGTGGTTTGTTATGGGTCCTCTATGCACTTACCACTGCCCTTCTCATGATACTTCTTCATGCAAGCCTGAGAACTCCAAA
CCTCAAGGCCCGCTTGAACACATTCCGTGAAGAATTCAGGGCTGTCTGGCGTAACTACAGCGAACTTTAA