Details for Arabidopsis Locus AT3G11330

Position : Chr3 ( 5`- 3551974 .. 3554763 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11330

Protein [Map View]
MAAEPNPKNFPVLSYVLARLPSFTAKSPSSSVPPFDIEQPPPSSSSSSIEIVTQMPHLTQPDVLASMTSAISDVAETRSI
LRTLGPRPDHESVDKARAKLSEIESFLSESFEDIALTDAAAKDEKRRQEMDQEKTWCESILKLDEVHASYEKLLKEAEER
LVRIYESAEKNAAEDEENVAAVEVNEEVVGILQHASANPVDRVDLSGRKLRLLPEAFGRIQGLLVLNLSNNKLESIPDSI
AGLHSLVELDVSTNSLETLPDSIGLLSKLKILNVSTNKLTSLPDSICRCGSLVILDVSFNRLTYLPTNIGPELVNLEKLL
VQYNKIRSFPTSIGEMRSLKHLDAHFNELNGLPDSFVLLTNLEYLNLSSNFSDLKDLPFSFGELISLQELDLSNNQIHAL
PDTFGTLDSLTKLNVDQNPLVVPPEEVVKEGVEAVKTYMGQRRISMLEEEEKKKMEEEMEQANAGWLTRTTSKLKTYVAD
VSEYLGSNSPRDPYLERQL*

DNA
ATGGCGGCAGAACCTAACCCTAAGAATTTCCCTGTCCTCTCTTATGTCTTGGCTCGTCTCCCTTCTTTCACCGCCAAATC
CCCTTCCTCCTCCGTTCCTCCCTTCGACATCGAACAACCACCACCATCATCATCATCATCATCGATTGAGATCGTCACTC
AGATGCCTCACTTAACACAACCAGATGTTCTCGCTTCAATGACAAGTGCGATCTCTGACGTCGCCGAGACTCGATCTATC
CTTCGAACCCTAGGACCTAGACCAGATCACGAATCAGTCGATAAGGCTCGTGCTAAACTCTCGGAAATCGAATCGTTCTT
ATCTGAATCGTTCGAGGATATCGCGTTAACCGATGCGGCGGCGAAAGATGAGAAGAGGAGACAAGAGATGGATCAGGAGA
AGACTTGGTGTGAGTCGATTTTGAAGCTTGATGAGGTTCATGCTTCGTATGAGAAGCTTTTGAAAGAAGCAGAGGAGAGG
CTTGTTAGGATTTATGAATCTGCTGAGAAGAATGCGGCGGAGGATGAGGAGAATGTTGCGGCTGTGGAGGTTAATGAGGA
GGTTGTTGGGATATTGCAGCATGCTTCTGCTAATCCGGTGGATCGTGTTGATTTGTCTGGGAGGAAACTGAGGTTGCTAC
CTGAAGCTTTTGGGAGGATTCAAGGGTTGCTTGTTCTTAATCTCTCCAACAATAAGCTTGAGTCGATTCCTGATTCAATT
GCTGGATTGCATAGTCTTGTTGAACTGGATGTCTCCACGAATTCTCTGGAGACATTACCTGATTCCATCGGTTTACTGTC
CAAACTAAAAATCCTGAATGTTTCGACTAACAAGCTCACATCCTTGCCTGACTCCATCTGCCGCTGTGGGTCGTTGGTTA
TCTTGGACGTGAGCTTCAACCGTCTCACCTACTTACCGACCAACATCGGTCCTGAGCTAGTGAATCTAGAAAAGCTCCTG
GTTCAGTATAACAAGATCCGATCCTTCCCGACCAGTATAGGCGAAATGAGATCCCTAAAACACCTCGACGCCCACTTCAA
CGAACTTAACGGCCTTCCTGATTCTTTCGTGTTGCTCACAAATCTCGAGTACTTAAACCTAAGCAGCAACTTCAGTGATC
TCAAGGATCTCCCATTCTCATTCGGCGAACTCATAAGCCTCCAAGAACTCGACTTGAGTAACAACCAAATCCATGCCCTC
CCTGACACTTTTGGCACACTTGATAGCCTGACCAAACTGAATGTGGATCAGAACCCGCTCGTCGTCCCACCCGAGGAAGT
GGTGAAGGAAGGTGTTGAAGCTGTGAAGACGTACATGGGTCAGAGAAGGATCAGTATGTTGGAAGAAGAAGAGAAGAAGA
AAATGGAGGAAGAGATGGAGCAGGCAAACGCCGGGTGGCTCACACGAACCACATCGAAGCTGAAAACATATGTCGCAGAT
GTTTCAGAGTATCTCGGATCAAATTCTCCTCGAGACCCTTACCTTGAACGACAGCTATGA