Details for Arabidopsis Locus AT3G11280

Position : Chr3 ( 5`- 3533255 .. 3534847 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11280

Protein [Map View]
METLHPFSHLPISDHRFVVQEMVSLHSSSSGSWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVFDVMKQYSKLEE
DVFDIEAGRVPIPGYPAASSPLGFDTDMCRKRPSGARGSDQDRKKGVPWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSK
TPTQVASHAQKYYQRQLSGAKDKRRPSIHDITTGNLLNANLNRSFSDHRDILPDLGFIDKDDTEEGVIFMGQNLSSENLF
SPSPTSFEAAINFAGENVFSAGA*

DNA
ATGGAGACTCTGCATCCATTCTCTCACCTACCTATCTCTGACCACCGGTTCGTTGTTCAAGAGATGGTGAGCTTACACAG
CTCGAGTAGCGGTAGCTGGACTAAAGAAGAGAACAAGATGTTCGAACGAGCTCTTGCGATATACGCTGAAGACTCGCCTG
ATCGCTGGTTTAAAGTTGCTTCCATGATCCCTGGAAAGACTGTTTTTGATGTTATGAAGCAATATAGTAAGCTTGAAGAA
GACGTTTTCGATATTGAAGCAGGACGTGTTCCCATTCCTGGTTATCCTGCAGCTTCTTCTCCCTTGGGGTTTGACACGGA
CATGTGTCGTAAACGGCCTAGTGGAGCTAGAGGATCTGATCAAGATCGAAAGAAAGGAGTCCCTTGGACAGAGGAAGAAC
ACAGGAGATTCTTGTTAGGCCTTCTCAAGTACGGTAAAGGAGATTGGAGAAACATATCGAGAAACTTCGTGGTGTCAAAG
ACGCCAACGCAAGTGGCGAGCCACGCCCAAAAGTATTACCAGAGACAGCTCTCCGGAGCCAAGGACAAACGCAGGCCAAG
TATCCATGACATCACAACCGGCAATCTTCTCAATGCCAATCTCAACCGTTCCTTTTCCGATCATAGAGATATTCTCCCTG
ATTTAGGGTTTATCGATAAGGATGATACGGAGGAGGGAGTAATATTTATGGGTCAGAATCTCTCTTCAGAAAATCTGTTT
TCTCCATCACCAACTTCATTCGAAGCTGCCATTAACTTCGCCGGAGAAAATGTCTTCAGTGCCGGAGCTTAA