Details for Arabidopsis Locus AT3G11260

Position : Chr3 ( 5`- 3527575 .. 3528433 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11260

Protein [Map View]
MSFSVKGRSLRGNNNGGTGTKCGRWNPTVEQLKILTDLFRAGLRTPTTDQIQKISTELSFYGKIESKNVFYWFQNHKARE
RQKRRKISIDFDHHHHQPSTRDVFEISEEDCQEEEKVIETLQLFPVNSFEDSNSKVDKMRARGNNQYREYIRETTTTSFS
PYSSCGAEMEHPPPLDLRLSFL*

DNA
ATGTCTTTCTCCGTGAAAGGTCGAAGCTTACGTGGCAACAATAACGGAGGAACGGGGACGAAGTGCGGGAGATGGAATCC
AACGGTGGAGCAGTTGAAGATATTGACTGATCTGTTTCGAGCCGGTCTTAGAACTCCAACAACTGATCAGATTCAGAAGA
TCTCTACGGAGCTCAGTTTCTACGGCAAGATAGAGAGCAAGAATGTTTTCTATTGGTTTCAGAATCATAAGGCTAGGGAG
AGGCAGAAACGTCGTAAAATCTCCATTGATTTTGATCATCATCATCATCAACCATCAACTAGAGATGTTTTTGAAATAAG
CGAAGAAGATTGTCAAGAGGAAGAGAAGGTGATAGAGACATTACAACTCTTTCCGGTGAATTCATTTGAAGACTCCAACT
CCAAGGTGGACAAAATGAGAGCTAGAGGCAATAACCAGTACCGTGAATATATTCGAGAGACCACCACGACGTCGTTTTCT
CCATACTCATCATGTGGAGCTGAAATGGAACATCCACCGCCATTAGATCTTCGATTAAGCTTTCTTTAA