Details for Arabidopsis Locus AT3G11250

Position : Chr3 ( 5`- 3521357 .. 3523001 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11250

Protein [Map View]
MVKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRIHSENSGNTAILNL
LPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPV
ELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAP
HMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKFVVAAAAVSADAGGGSAQAGAAAKVEEKKEESDEEDYEGGFGLF
DEE*

DNA
ATGGTGAAGGCAACAAAAGCAGAGAAGAAGATAGCGTATGACACAAAACTATGTCAGCTTATCGACGAATACACTCAGAT
CTTAGTCGTTGCGGCGGACAACGTCGGATCGACTCAGCTTCAGAACATCAGGAAAGGTCTTCGTGGAGACTCAGTGGTTC
TCATGGGTAAGAACACTATGATGAAACGTTCCGTTAGAATCCACTCCGAGAACTCTGGAAACACTGCAATTTTGAATCTG
CTTCCCCTCCTTCAGGGAAACGTTGGTTTGATCTTCACTAAAGGTGATCTCAAGGAAGTGAGCGAGGAGGTTGCCAAATA
CAAGGTTGGTGCTCCTGCTCGTGTGGGTTTAGTTGCTCCTATTGATGTGGTTGTTCAACCTGGCAACACTGGTCTTGACC
CATCTCAAACATCGTTCTTCCAGGTGCTTAACATTCCCACTAAGATTAACAAGGGTACTGTTGAAATTATCACCCCTGTG
GAGCTTATCAAGCAAGGTGACAAGGTTGGGTCTTCTGAGGCTGCCCTTCTAGCTAAGCTTGGCATTAGGCCTTTCTCGTA
TGGTCTAGTTGTTCAGTCGGTTTATGATAATGGATCAGTCTTCAGTCCAGAGGTTCTTGATCTTACTGAAGATCAACTTG
TTGAAAAGTTTGCTTCTGGTATCTCTATGGTCACTTCCTTGGCTCTAGCTGTTTCTTACCCTACCCTTGCGGCTGCACCG
CATATGTTCATCAATGCCTACAAGAATGCTTTAGCTATTGCTGTTGCTACTGACTACACTTTCCCTCAAGCAGAGAAGGT
CAAGGAATTCTTAAAGGATCCCAGCAAGTTTGTTGTTGCTGCAGCGGCAGTGTCTGCGGATGCAGGTGGTGGTAGTGCTC
AAGCTGGAGCTGCAGCTAAGGTAGAGGAGAAGAAAGAAGAATCAGACGAAGAAGACTATGAGGGTGGTTTCGGTTTGTTT
GACGAAGAGTAG