Details for Arabidopsis Locus AT3G11230

Position : Chr3 ( 5`- 3516577 .. 3518385 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11230

Protein [Map View]
MIVFPFITHSFIILLSKRFDFFFAFIDSGNSLEMGRLFLVNLEGKSYSCKHCKTNLALCDDVVSKSFQSRHGKAYLFSKV
VNVYAGKKEDRMMMTGMHTVVDIYCVKCGSYVGWKYEFAFEKNQKYKEGKSVLERYKVWGPDGNNYWVAQEVEAGDSDTD
DA*

DNA
ATGATCGTCTTCCCTTTTATCACACACTCTTTTATTATTTTGCTCAGCAAAAGATTTGATTTTTTTTTTGCTTTTATAGA
TTCTGGGAATAGTTTAGAGATGGGGAGATTGTTCTTGGTGAATTTGGAAGGCAAGTCTTACAGTTGTAAGCACTGCAAGA
CCAATCTTGCTCTCTGTGATGATGTCGTCTCTAAGTCTTTTCAGTCCCGACATGGGAAAGCTTACCTCTTCAGTAAGGTA
GTGAATGTGTATGCTGGCAAGAAAGAAGATAGGATGATGATGACGGGAATGCATACGGTGGTCGATATTTACTGTGTCAA
ATGCGGCTCTTATGTTGGATGGAAATATGAGTTTGCTTTTGAGAAGAATCAAAAGTACAAGGAAGGAAAATCTGTTCTCG
AAAGGTACAAGGTCTGGGGTCCAGATGGGAACAATTATTGGGTGGCTCAAGAAGTTGAAGCCGGAGACAGCGATACTGAT
GATGCTTGA