Details for Arabidopsis Locus AT3G11220

Position : Chr3 ( 5`- 3513531 .. 3516408 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11220

Protein [Map View]
MAAPNVRSSSSFSRNISVVSSPQIPGLKSGPNGTAFISSGIRDLDRILGGGYPLGSLVMVMEDPEAPHHMDLLRTYMSQG
LVNNQPLLYASPSKDPKGFLGTLPHPASSKEDKPTAPDPDQGESLRIAWQYRKYLENQKNAIDDYSNDFDMRKPLERQFL
SGRPIDCVSLLDSSDLSIAQDHCATFLSKFPSKFCSSSILFTSLLYFQAQNSSNIASIGRIAIQSFCSPLCEYSEKESDM
LSFIRLLKSMLMVSNAVAIVTFPPSLLSPSSSKRLQHMADTLLSIKAIPDGDKELEKLLTGYKDINGFLNIHKVARINTQ
VPVILEAKTFSMSLKKRRFLALECLNQAPVDGSSGTSYGTSGSCSSKSGALDF*

DNA
ATGGCTGCACCAAACGTTCGTAGTAGTAGCAGCTTCTCTCGCAACATATCAGTTGTGTCATCGCCTCAAATTCCTGGTCT
CAAAAGTGGTCCTAATGGCACAGCTTTTATATCGTCAGGGATTCGTGATCTTGACAGGATACTAGGTGGTGGGTATCCTT
TGGGAAGCTTAGTAATGGTAATGGAAGATCCTGAAGCACCGCATCATATGGATCTGTTAAGAACTTACATGTCTCAGGGG
CTTGTTAACAATCAACCACTTCTTTATGCTAGTCCTTCAAAAGATCCAAAAGGGTTTCTTGGTACTTTGCCGCATCCTGC
ATCATCCAAAGAGGATAAGCCTACTGCGCCCGACCCTGATCAGGGAGAGAGCTTGAGGATTGCTTGGCAGTATCGGAAGT
ATTTGGAAAACCAGAAGAATGCTATTGATGATTACTCCAATGACTTTGATATGAGAAAGCCCTTGGAGAGGCAATTTCTG
AGCGGACGGCCCATAGATTGTGTCAGTCTGTTAGACTCTTCAGATCTTTCCATTGCTCAGGACCACTGTGCTACGTTTTT
ATCAAAATTTCCAAGCAAATTCTGCTCAAGCTCAATTCTTTTTACATCTCTCTTATACTTCCAAGCTCAAAACAGCAGTA
ACATTGCATCTATTGGCCGCATCGCAATCCAGTCTTTTTGCTCTCCCCTGTGTGAGTATTCTGAAAAGGAATCAGACATG
CTCTCATTCATAAGATTGCTGAAAAGTATGCTTATGGTTTCAAATGCGGTAGCCATTGTTACTTTCCCGCCTTCCCTGCT
CTCCCCATCTTCCTCTAAAAGACTGCAGCATATGGCAGATACCTTGCTCTCTATCAAAGCAATCCCAGATGGTGACAAGG
AATTGGAGAAACTCCTCACTGGCTACAAGGATATAAATGGATTCCTCAACATACACAAGGTTGCTCGTATCAACACACAG
GTGCCTGTAATTCTTGAGGCAAAAACCTTCTCAATGAGCTTGAAGAAGAGAAGATTCTTGGCTCTAGAGTGTCTGAATCA
AGCCCCTGTAGACGGGTCCAGTGGAACATCGTATGGCACATCTGGTAGCTGCTCATCCAAATCCGGAGCACTAGATTTTT
GA