Details for Arabidopsis Locus AT3G11210

Position : Chr3 ( 5`- 3510663 .. 3513060 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11210

Protein [Map View]
MVGPARPQIVLFGSSIVQMSFGHGGWGAILSEVYARKADIILRGYYGWNSSRALEVVDQVFPKDAAVQPSLVIVYFGGND
SMAPHSSGLGPHVPLTEYVDNMKKIALHLQSLSDFTRIIFLSSPPVDEAKVRQNQSPYLSEVIRTNDLCKTYSDACVELC
QELGLEVVDLFSTFQKADDWKTVCFTDGIHLSAQGSKIVAGEILRVVKEAEWHPSLHWKSMPTEFADDSPYDLVSADGKQ
TVNSSEWTYFWEEQWD*

DNA
ATGGTTGGACCCGCGCGGCCTCAGATCGTTTTGTTTGGATCTTCCATTGTTCAGATGAGCTTTGGCCATGGTGGTTGGGG
CGCCATTCTTTCCGAGGTCTACGCTCGTAAGGCCGACATCATTCTGCGAGGATATTATGGATGGAACTCTTCTCGTGCTT
TGGAAGTTGTCGACCAAGTGTTCCCCAAGGATGCTGCAGTACAACCTTCTCTGGTCATTGTCTATTTTGGAGGAAACGAC
TCAATGGCGCCTCACTCGTCTGGACTAGGACCTCATGTACCACTTACTGAATATGTTGATAACATGAAGAAGATCGCTCT
TCATCTTCAGAGCCTTTCAGACTTCACCCGAATCATATTTCTTAGTTCTCCTCCAGTGGATGAGGCTAAAGTTCGCCAGA
ACCAAAGCCCATACTTGAGCGAGGTAATCCGCACAAACGACCTCTGCAAGACTTATTCAGATGCTTGTGTAGAGCTGTGC
CAAGAACTCGGCCTAGAAGTAGTTGATCTCTTCTCTACTTTTCAGAAAGCAGATGACTGGAAAACTGTTTGCTTCACAGA
CGGGATTCATTTGTCAGCACAAGGAAGCAAAATAGTAGCGGGAGAGATACTAAGAGTGGTTAAAGAAGCGGAATGGCATC
CATCACTTCACTGGAAATCAATGCCAACAGAATTCGCAGATGACTCTCCTTATGATCTTGTATCAGCAGATGGCAAACAG
ACAGTAAATTCTTCAGAATGGACTTATTTCTGGGAAGAACAATGGGACTAA