Details for Arabidopsis Locus AT3G11200

Position : Chr3 ( 5`- 3508042 .. 3510627 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11200

Protein [Map View]
MAAAAVSSNPRTVEEIFKDYSARRAALLRALTKDVDDFYSQCDPEKENLCLYGHPNESWEVNLPAEEVPPELPEPALGIN
FARDGMQRKDWLSLVAVHSDCWLLSVSFYFGARLNRNERKRLFSLINDLPTLFDVVTGRKAMKDNKPSSDSGSKSRNGTK
RSIDGQTKSSTPKLMEESYEEEEEEDEHGDTLCGSCGGHYTNEEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPPCC
AKKGRQ*

DNA
ATGGCCGCCGCAGCCGTTTCCTCTAACCCTCGCACCGTTGAAGAGATCTTCAAAGATTATTCCGCTCGTCGTGCCGCTCT
TCTTCGTGCTCTCACTAAAGATGTTGATGATTTTTACTCTCAATGCGATCCGGAAAAGGAGAATTTGTGTTTGTACGGAC
ACCCTAATGAGTCATGGGAAGTGAATCTACCAGCAGAGGAAGTGCCTCCGGAGCTACCTGAGCCTGCTCTTGGTATCAAT
TTCGCTAGAGATGGTATGCAGAGGAAAGATTGGCTTTCTCTTGTTGCTGTTCACAGTGATTGTTGGTTGCTCTCTGTTTC
TTTCTACTTTGGAGCCCGTCTTAATCGCAATGAGAGGAAGCGGTTATTCAGTCTGATCAACGATCTCCCAACTCTCTTCG
ATGTAGTGACTGGTAGGAAAGCCATGAAAGACAACAAGCCAAGCTCGGACTCAGGAAGCAAATCCAGAAATGGCACTAAG
AGATCAATAGACGGGCAGACAAAGAGCTCAACACCGAAACTAATGGAAGAGAGCTATGAGGAGGAGGAAGAAGAAGACGA
GCATGGAGACACTCTCTGTGGAAGCTGTGGAGGTCATTACACAAATGAGGAGTTCTGGATTTGCTGTGATGTTTGTGAAC
GTTGGTACCATGGAAAATGCGTCAAGATAACTCCGGCTAAAGCAGAGAGCATCAAGCAGTATAAATGCCCGCCTTGCTGT
GCAAAGAAAGGAAGACAGTGA