Details for Arabidopsis Locus AT3G11180

Position : Chr3 ( 5`- 3504204 .. 3507113 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11180

Protein [Map View]
MNNLDEIKIESKTCLNDQEQEVKIDNMHMSDQDKNKIEIKNKSGLGEKWPEPIVRVQSLAESNLTSLPDRYIKPPSQRPQ
TTIIDHQPEVADINIPIIDLDSLFSGNEDDKKRISEACREWGFFQVINHGVKPELMDAARETWKSFFNLPVEAKEVYSNS
PRTYEGYGSRLGVEKGAILDWNDYYYLHFLPLALKDFNKWPSLPSNIREMNDEYGKELVKLGGRLMTILSSNLGLRAEQL
QEAFGGEDVGACLRVNYYPKCPQPELALGLSPHSDPGGMTILLPDDQVVGLQVRHGDTWITVNPLRHAFIVNIGDQIQIL
SNSKYKSVEHRVIVNSEKERVSLAFFYNPKSDIPIQPMQQLVTSTMPPLYPPMTFDQYRLFIRTQGYRSYGSLKNYLEIP
KDW*

DNA
ATGAACAACCTAGACGAGATCAAGATCGAGAGCAAGACCTGCCTCAACGATCAAGAACAAGAAGTCAAAATAGACAACAT
GCACATGAGCGACCAAGACAAGAACAAGATCGAAATCAAGAACAAGAGTGGCCTCGGCGAAAAGTGGCCAGAACCCATCG
TCCGAGTCCAATCTCTAGCCGAGAGCAACCTCACTAGTCTCCCTGACCGTTACATCAAGCCGCCGTCTCAACGCCCTCAA
ACCACCATCATCGACCACCAACCGGAAGTAGCTGACATAAATATACCGATCATAGACCTAGACAGTCTATTCTCTGGCAA
TGAAGACGACAAGAAGAGGATATCCGAGGCATGCCGTGAATGGGGATTCTTCCAGGTAATCAACCATGGCGTGAAGCCGG
AGCTGATGGACGCAGCTAGAGAAACTTGGAAGAGCTTCTTTAATTTGCCTGTTGAAGCCAAAGAAGTTTACTCAAACTCC
CCAAGAACCTATGAAGGATATGGAAGCAGATTGGGTGTGGAAAAAGGAGCCATTCTTGATTGGAATGATTATTACTATCT
CCATTTTCTTCCTCTTGCCTTGAAGGATTTCAACAAATGGCCTTCTTTACCTTCCAACATTAGAGAAATGAATGATGAGT
ACGGTAAGGAACTAGTGAAGCTAGGTGGGAGACTAATGACGATCTTATCGTCAAATTTGGGGCTAAGAGCAGAACAACTT
CAAGAAGCATTTGGTGGAGAAGACGTTGGTGCATGTTTGAGGGTTAATTATTACCCAAAGTGCCCTCAACCGGAGCTTGC
CCTCGGCCTCTCCCCTCATTCTGATCCCGGCGGCATGACCATCCTCTTGCCGGACGATCAAGTCGTCGGCCTTCAGGTCC
GTCACGGTGACACGTGGATCACTGTCAATCCTCTCCGCCACGCTTTTATCGTCAATATCGGCGATCAAATTCAGATACTA
AGCAATTCGAAATACAAGAGCGTGGAACATCGAGTGATAGTGAATTCGGAAAAAGAAAGGGTTTCACTAGCATTCTTCTA
TAACCCTAAGAGTGACATTCCGATCCAACCAATGCAACAACTTGTCACCTCTACGATGCCTCCCTTGTATCCTCCCATGA
CCTTTGATCAATATAGACTCTTCATTAGAACGCAAGGATACCGAAGCTATGGAAGCTTAAAGAACTACCTAGAGATTCCA
AAAGATTGGTGA