Details for Arabidopsis Locus AT3G11100

Position : Chr3 ( 5`- 3476187 .. 3477405 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11100

Protein [Map View]
METTPETQSKTHRLPAGREDWWSEDATATLIEAWGDRYVNLNRGNLRQNDWKEVADAVNSSHGNGRPKTDVQCKNRIDTL
KKKYKTEKAKPLSNWCFFDRLDFLIGPVMKKSSGAVVKSALMNPNLNPTGSKSTGSSLDDDDDDDDDDEEDDDDAGDWGF
VVRKHRKVEDVDSSEGSAFRELARSILKLGEAFERIEGKKQQMMIELEKQRMEVAKELELQRMNMLMEMQLELEKSKLGK
RRAASGKKL*

DNA
ATGGAGACGACGCCGGAGACTCAGTCGAAGACTCACCGTCTACCGGCGGGAAGAGAGGATTGGTGGAGCGAAGACGCTAC
GGCGACATTGATCGAAGCTTGGGGAGATCGTTACGTCAATCTCAACCGGGGAAATCTCCGGCAAAACGATTGGAAAGAAG
TCGCCGACGCCGTCAATTCAAGCCACGGGAATGGCCGGCCAAAGACCGATGTACAGTGCAAAAACCGGATCGATACGTTG
AAGAAGAAGTACAAAACTGAAAAGGCGAAACCTTTATCGAATTGGTGCTTCTTTGATAGACTCGATTTCTTAATCGGTCC
GGTTATGAAGAAATCGTCCGGTGCTGTTGTTAAATCGGCGTTGATGAACCCTAATTTGAATCCTACTGGATCTAAATCAA
CTGGTAGCTCTCTCGATGACGATGATGATGATGATGATGACGACGAAGAAGATGATGATGATGCGGGTGATTGGGGATTT
GTGGTGAGGAAGCATCGTAAAGTTGAAGATGTAGATTCGAGTGAAGGATCAGCCTTTAGGGAGCTAGCGAGATCGATTCT
GAAGTTAGGGGAAGCGTTTGAGAGAATCGAGGGGAAGAAGCAACAGATGATGATTGAATTGGAGAAACAGAGAATGGAAG
TTGCAAAGGAGCTTGAGTTACAACGAATGAATATGTTGATGGAGATGCAATTGGAGCTTGAGAAATCTAAACTTGGGAAA
CGAAGAGCTGCTTCAGGTAAGAAGTTGTAG