Details for Arabidopsis Locus AT3G11090

Position : Chr3 ( 5`- 3475002 .. 3475604 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11090

Protein [Map View]
MRGHEPRSSSSCAACKLLKRRCTPTCIFAPYFRSSDLITFAKVHKVFGASNVSKLLGEVPEEQRQETVNSLAYEAEVRLK
DPVYGCIGAIASLQKKMLELQHDLAVARTRLLAHSGVNNSQVSPLDDSPELAAFLDLVPYSDLMLLDGSTNLDAYLYDLG
QPPFV*

DNA
ATGAGAGGGCATGAGCCACGATCAAGCTCATCTTGTGCAGCCTGCAAGCTCTTGAAGAGACGATGCACACCCACTTGCAT
TTTCGCTCCTTATTTCCGCTCAAGTGACTTGATAACTTTCGCCAAAGTCCATAAAGTCTTTGGAGCCAGCAACGTCAGTA
AGCTTCTCGGTGAAGTTCCTGAAGAACAGAGACAAGAAACCGTTAACTCCTTGGCTTATGAAGCTGAGGTTCGTCTCAAG
GATCCTGTTTACGGTTGCATTGGAGCCATAGCGTCTCTGCAGAAGAAGATGCTCGAGCTTCAACACGATCTAGCTGTTGC
TCGCACTCGACTACTTGCCCATTCTGGGGTCAACAACAGCCAAGTGTCCCCTTTGGATGATTCTCCTGAGCTTGCTGCTT
TTCTTGATCTTGTACCTTATAGTGACTTGATGTTGCTTGATGGGTCTACTAATCTTGATGCTTACTTGTATGATCTTGGA
CAGCCTCCTTTTGTATAG