Details for Arabidopsis Locus AT3G11050

Position : Chr3 ( 5`- 3463598 .. 3465506 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11050

Protein [Map View]
MLHKASPALSLLSSGYTGGGNLFPPSRNSSNLLFSPSGSRFSVQAAKGTNTKSLTGVVFEPFEEVKKEMELVPTTPFVSL
ARHKFSDDSESAINDQINVEYNVSYVYHALYAYFDRDNVGLKGFAKFFNDSSLEERGHAEMFMEYQNKRGGRVKLQSILM
PVSEFDHEEKGDALHAMELALSLEKLTNEKLLKLQSVGVKNNDVQLVDFVESEFLGEQVEAIKKISEYVAQLRRIGKGHG
VWHFDQMLLNDEV*

DNA
ATGTTGCACAAGGCTTCTCCCGCTCTCTCTCTCTTGAGCTCCGGCTACACCGGCGGTGGAAATCTGTTTCCTCCGTCGAG
AAATTCGTCGAATCTTCTGTTTTCTCCGAGTGGATCCAGGTTTTCTGTTCAGGCGGCGAAAGGAACGAACACGAAGTCGT
TAACCGGAGTTGTATTCGAACCTTTTGAGGAGGTGAAGAAAGAAATGGAGCTCGTTCCCACTACCCCTTTTGTTTCTCTC
GCTCGCCACAAGTTCTCCGACGATTCTGAATCTGCCATCAACGATCAGATCAACGTGGAGTACAACGTCTCGTATGTCTA
CCATGCCCTGTATGCCTACTTTGACAGAGACAATGTCGGCTTGAAAGGTTTCGCCAAGTTTTTTAACGATTCGAGTCTTG
AAGAACGAGGTCATGCTGAGATGTTTATGGAGTATCAGAACAAGCGTGGTGGGAGAGTGAAGCTGCAGTCTATTTTGATG
CCCGTCTCTGAGTTTGATCACGAGGAGAAGGGAGATGCATTGCATGCGATGGAGCTTGCATTGTCTTTGGAGAAACTTAC
AAATGAAAAGCTTCTGAAGTTACAAAGTGTTGGTGTGAAGAACAATGATGTTCAGCTGGTTGATTTTGTAGAATCTGAGT
TTCTAGGCGAGCAGGTCGAAGCTATCAAGAAAATCTCAGAGTACGTTGCACAGCTAAGAAGAATAGGAAAGGGTCATGGA
GTGTGGCATTTTGATCAAATGCTTCTCAATGATGAGGTTTAA