Details for Arabidopsis Locus AT3G11020

Position : Chr3 ( 5`- 3455355 .. 3457214 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G11020

Protein [Map View]
MAVYEQTGTEQPKKRKSRARAGGLTVADRLKKWKEYNEIVEASAVKEGEKPKRKVPAKGSKKGCMKGKGGPDNSHCSFRG
VRQRIWGKWVAEIREPKIGTRLWLGTFPTAEKAASAYDEAATAMYGSLARLNFPQSVGSEFTSTSSQSEVCTVENKAVVC
GDVCVKHEDTDCESNPFSQILDVREESCGTRPDSCTVGHQDMNSSLNYDLLLEFEQQYWGQVLQEKEKPKQEEEEIQQQQ
QEQQQQQLQPDLLTVADYGWPWSNDIVNDQTSWDPNECFDINELLGDLNEPGPHQSQDQNHVNSGSYDLHPLHLEPHDGH
EFNGLSSLDI*

DNA
ATGGCTGTATATGAACAAACCGGAACCGAGCAGCCGAAGAAAAGGAAATCTAGGGCTCGAGCAGGTGGTTTAACGGTGGC
TGATAGGCTAAAGAAGTGGAAAGAGTACAACGAGATTGTTGAAGCTTCGGCTGTTAAAGAAGGAGAGAAACCGAAACGCA
AAGTTCCTGCGAAAGGGTCGAAGAAAGGTTGTATGAAGGGTAAAGGAGGACCAGATAATTCTCACTGTAGTTTTAGAGGA
GTTAGACAAAGGATTTGGGGTAAATGGGTTGCAGAGATTCGAGAACCGAAAATAGGAACTAGACTTTGGCTTGGTACTTT
TCCTACCGCGGAAAAAGCTGCTTCCGCTTATGATGAAGCGGCTACCGCTATGTACGGTTCATTGGCTCGTCTTAACTTCC
CTCAGTCTGTTGGGTCTGAGTTTACTAGTACGTCTAGTCAATCTGAGGTGTGTACGGTTGAAAATAAGGCGGTTGTTTGT
GGTGATGTTTGTGTGAAGCATGAAGATACTGATTGTGAATCTAATCCATTTAGTCAGATTTTAGATGTTAGAGAAGAGTC
TTGTGGAACCAGGCCGGACAGTTGCACGGTTGGACATCAAGATATGAATTCTTCGCTGAATTACGATTTGCTGTTAGAGT
TTGAGCAGCAGTATTGGGGCCAAGTTTTGCAGGAGAAAGAGAAACCGAAGCAGGAAGAAGAGGAGATACAGCAACAGCAA
CAGGAACAGCAACAGCAACAGCTGCAACCGGATTTGCTTACTGTTGCAGATTACGGTTGGCCTTGGTCTAATGATATTGT
AAATGATCAGACTTCTTGGGATCCTAATGAGTGCTTTGATATTAATGAACTCCTTGGAGATTTGAATGAACCTGGTCCCC
ATCAGAGCCAAGACCAAAACCACGTAAATTCTGGTAGTTATGATTTGCATCCGCTTCATCTCGAGCCACACGATGGTCAC
GAGTTCAATGGTTTGAGTTCTCTGGATATTTGA