Details for Arabidopsis Locus AT3G10990

Position : Chr3 ( 5`- 3446462 .. 3446995 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10990

Protein [Map View]
MIECCKPHVPRGTEICINSVLYYTAVEKGSLMVTIVVCFDISSEKFSFMKVMETFDRDLPSSTTMINYNGKLGLLMTEES
TDIVSGTSKSFELRVLEDAEKHDWSKHVYMLPPLWKNVVGEETKLRLLGMVGSCTNEIVFSYKYPSTFMPSYVFYYNIER
NTIIRLEIQGMEELNGK*

DNA
ATGATTGAATGTTGCAAACCCCATGTTCCTCGTGGTACTGAAATATGCATTAACAGTGTTTTGTATTATACTGCCGTCGA
AAAAGGGTCTTTAATGGTTACTATAGTAGTTTGCTTCGATATTAGCTCGGAGAAGTTCAGCTTTATGAAAGTCATGGAAA
CTTTCGATAGAGATTTGCCTAGTTCAACAACTATGATAAACTACAATGGCAAATTAGGTTTGTTGATGACGGAAGAGTCT
ACCGATATTGTTAGTGGAACAAGTAAAAGTTTCGAGTTGCGGGTCCTAGAAGACGCTGAAAAACATGATTGGTCGAAGCA
TGTATACATGTTGCCTCCTCTGTGGAAGAATGTAGTTGGAGAAGAGACCAAGCTACGACTTCTTGGAATGGTTGGCAGTT
GCACCAATGAAATTGTGTTTTCGTACAAGTACCCATCTACATTTATGCCTTCCTACGTCTTCTACTACAATATCGAGAGG
AACACGATCATAAGACTTGAAATCCAAGGAATGGAAGAGCTTAACGGTAAGTGA