Details for Arabidopsis Locus AT3G10986

Position : Chr3 ( 5`- 3444203 .. 3445672 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10986

Protein [Map View]
MVSVVGEMFCNPYTTELVVRRRRESLKRERYDVFDLSNNLIFTVDGGIWNIRRKRVLRDAAGIPLLSMRTKGLVPMRYNW
EVYKGDSTESDNLLFSAREPNLLSFKTSLDVTLPPDQSSTDISSVEPDFQTFGRYIGSSFKLFEPIHNTLLAEVVHDFTW
GGLIKGSYSFKVRVNPYVDFAFVVALLVITDDTSNLR*

DNA
ATGGTGAGTGTTGTGGGAGAGATGTTTTGTAATCCGTACACGACGGAGCTGGTGGTGAGAAGGCGGCGTGAGAGCCTGAA
AAGGGAACGCTACGACGTTTTCGATCTTTCTAACAATCTCATCTTCACCGTGGACGGTGGCATTTGGAACATCCGCCGTA
AACGTGTCCTCCGTGACGCCGCCGGAATTCCTCTTCTCTCCATGCGTACTAAGGGACTAGTACCAATGCGATACAATTGG
GAAGTATACAAAGGAGATAGCACAGAATCTGATAATCTTCTTTTCTCAGCAAGGGAACCAAATCTATTATCCTTCAAAAC
ATCACTTGATGTCACTTTACCGCCAGACCAATCTTCAACGGACATAAGTAGTGTCGAGCCAGATTTTCAAACATTTGGTC
GTTATATCGGCTCTTCTTTCAAACTCTTCGAGCCAATTCACAATACTCTTCTTGCTGAGGTGGTTCATGATTTCACATGG
GGAGGACTCATAAAAGGGAGTTACAGCTTCAAAGTGAGAGTTAATCCATATGTGGATTTCGCATTTGTCGTGGCGTTACT
TGTAATCACAGATGATACTTCCAATCTACGTTAG