Details for Arabidopsis Locus AT3G10980

Position : Chr3 ( 5`- 3438278 .. 3440809 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10980

Protein [Map View]
MGSNCDGNLKAEIEESNGSSGKNTKVPPCPLDVSTSRRTLIGDGKPRRWSISALPDASSRFQLLKFGSPSAKFKKMAEDR
DEVSRSVTSSSNGSSHNFRERISGVLHRKIDWSSLMNMGKEWIRNPINMALFVWILVVAVSGAILFMVMTGMLNHALPKK
SQRDAWFEVNNQILNGLFTLMCLYQHPKRFYHLVLLCRWKHDDITKLRKAYCKDGTYKPNEWMHIMVVVILLHLNCFAQY
ALCGLNVGYRRSERPPIGVAICISAAIGAPAVAGLYTILSPLGKDYNDSNEDEENQLKQREEGSVNRRFTLERRYSFASA
STGVGDGMVPVSDPQWSGGILDIWDDISLAYLSLFCTFCVFGWNMERVGFGNMYVHIATFILFCLAPFFIFNLAAVNIDN
ETVREALGISGILLCVFGLLYGGFWRIQMRKRFKLPSYNFCFGRAAIADCALWLCCCWCSLAQEVRTANSYEIVEDKFCQ
RKEEKNMVSPNLVSPLPREDGVFDPRFGLGSSPKNISGASSPSPSRFWKEAHSPNVQTPREKEEVKSDVALTPPSPLSIH
REA*

DNA
ATGGGATCTAATTGTGATGGGAATTTGAAAGCAGAGATTGAAGAATCTAATGGTTCTTCTGGCAAAAATACTAAGGTTCC
TCCTTGTCCTCTTGATGTTTCTACATCTAGAAGAACTTTGATTGGTGATGGTAAACCTAGGAGATGGTCTATTAGTGCTT
TACCTGATGCTTCTAGTAGATTCCAGCTTCTCAAATTTGGTTCTCCTTCTGCTAAGTTCAAGAAAATGGCTGAGGATAGA
GACGAGGTTTCACGGTCAGTGACTAGCTCAAGTAACGGAAGCAGTCATAATTTCAGGGAAAGAATCAGTGGCGTGCTTCA
CCGGAAAATAGATTGGAGTTCTCTGATGAATATGGGGAAAGAATGGATTAGGAATCCTATTAACATGGCTTTATTCGTTT
GGATACTTGTTGTTGCAGTCTCTGGTGCTATTCTCTTCATGGTTATGACTGGTATGTTGAATCATGCTTTGCCTAAGAAG
TCACAGAGAGATGCTTGGTTTGAAGTTAACAATCAGATTCTTAATGGCTTGTTTACTTTGATGTGTCTTTATCAACATCC
CAAACGGTTTTATCACTTAGTGCTTCTTTGTAGATGGAAGCATGATGATATTACTAAGCTTAGGAAAGCTTATTGCAAGG
ATGGGACTTATAAGCCTAATGAATGGATGCACATTATGGTTGTTGTCATTTTGCTTCACTTGAATTGTTTTGCTCAGTAC
GCGCTTTGTGGTCTTAATGTTGGATACAGGAGATCAGAGAGACCTCCCATTGGAGTTGCTATATGTATCTCTGCTGCCAT
TGGAGCTCCTGCGGTTGCGGGTTTGTACACTATACTAAGTCCACTTGGGAAAGATTATAATGATTCTAATGAAGACGAGG
AGAATCAACTGAAGCAACGTGAAGAAGGGTCTGTTAATCGTCGGTTTACTTTAGAGAGGAGGTATTCGTTTGCCTCTGCT
TCCACGGGGGTTGGGGATGGGATGGTTCCGGTGAGTGATCCTCAGTGGAGTGGTGGAATTTTGGATATTTGGGATGATAT
TTCATTGGCTTATCTTTCTCTTTTCTGCACTTTCTGTGTCTTTGGATGGAACATGGAGAGAGTTGGGTTTGGGAACATGT
ATGTTCACATAGCTACGTTTATTCTCTTCTGTTTGGCACCTTTCTTTATATTCAACTTAGCTGCGGTTAATATCGATAAT
GAGACGGTCAGGGAGGCGTTAGGGATATCTGGAATCCTTCTTTGTGTGTTTGGTTTGCTCTATGGTGGATTCTGGAGAAT
TCAGATGAGGAAAAGATTCAAATTACCGAGTTATAATTTCTGTTTCGGTAGAGCCGCGATTGCTGATTGTGCGCTCTGGT
TATGTTGTTGTTGGTGCTCTTTAGCACAAGAAGTTAGGACTGCAAACTCTTATGAGATAGTGGAAGACAAATTCTGCCAA
AGAAAAGAAGAGAAGAATATGGTATCTCCGAATTTGGTATCACCTTTGCCTCGTGAAGACGGTGTGTTTGATCCTCGGTT
TGGTCTCGGGAGCTCCCCTAAGAACATAAGTGGAGCTAGTTCTCCTAGCCCGAGCAGGTTTTGGAAAGAGGCACATAGCC
CAAATGTACAGACACCTAGAGAGAAAGAAGAGGTTAAAAGCGATGTTGCTCTGACTCCACCTTCTCCTCTGTCTATACAC
CGAGAAGCTTGA