Details for Arabidopsis Locus AT3G10960

Position : Chr3 ( 5`- 3424813 .. 3426997 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10960

Protein [Map View]
MEQQQQQQLPSTTTRPKPKLLNRLNTYVGSSRVGKRFKLAERNSTFTTELRAGTATFLTMAYILAVNASILSDSGGTCSV
SDCIPLCSNPAIEPSQCTGPGLRLIQPDVSCKFNPVNPGYAACVEEIRKDLIVATVAASLIGCVIMGLMANLPLALAPGM
GTNAYFAYTVVGFHGSGSISYRTALAAVFIEGLIFLFISAIGFRAKLAKLVPKPVRISSSAGIGLFLAFIGLQNNQGIGL
VGYSPSTLVTLAACPASSRISLAPVITSANGTVSLLAGGSVSGDIMCIHGRMESPTFWLGIVGFVIIAYCLVKNVKGAMI
YGIVFVTAVSWFRNTEVTAFPNTSAGDAAHDYFKKIVDVHVIKHTAGALSFSGINKGHFWEALVTFLYVDILDTTGTLYS
MARFAGFVDEKGDFAGQYFAFMSDASAIVIGSLLGTSPVTVFIESSTGIREGGRTGLTAITVAVYFLLAMFFTPLLASIP
AWAVGPPLILVGVMMMKSVTEIDWEDMREAIPAFVTMILMPLTYSVAYGLIGGIGSYVVLHLWDWGEEGLVKLGFLKRKV
KEEDNNNGVVKASEIDTTV*

DNA
ATGGAGCAACAGCAACAACAACAACTACCTTCTACTACTACTAGACCCAAGCCCAAGCTACTAAACCGGCTCAATACCTA
CGTCGGTTCGAGCCGGGTTGGCAAACGGTTCAAACTCGCCGAACGTAATTCAACTTTCACGACGGAGCTCCGTGCTGGTA
CCGCCACTTTCTTAACCATGGCTTATATCCTCGCCGTCAACGCTTCAATCCTTTCTGATTCCGGTGGTACTTGCTCTGTT
TCCGATTGTATCCCTCTATGCTCAAACCCAGCGATCGAACCTTCGCAGTGTACCGGACCGGGTCTCCGATTAATCCAACC
CGACGTTTCCTGTAAATTCAACCCGGTTAATCCTGGTTACGCCGCATGCGTTGAAGAAATTCGAAAGGATCTAATCGTCG
CCACCGTAGCTGCGTCACTAATCGGTTGTGTAATCATGGGATTGATGGCGAATCTTCCTCTAGCTTTAGCTCCGGGAATG
GGAACTAACGCTTATTTCGCTTACACCGTCGTTGGATTTCACGGATCCGGTTCAATCTCATACCGGACCGCACTCGCCGC
CGTTTTCATCGAAGGACTGATATTTCTCTTCATCTCCGCCATAGGTTTCAGAGCAAAACTTGCGAAACTCGTTCCTAAAC
CGGTCAGAATCAGTTCCTCCGCCGGAATCGGACTTTTCCTCGCTTTCATCGGTTTACAGAACAATCAAGGAATCGGTTTA
GTCGGTTATAGTCCTTCAACACTAGTCACTCTCGCCGCTTGTCCAGCCTCATCACGAATATCGTTAGCTCCCGTTATAAC
GTCAGCTAACGGAACCGTTAGTTTACTCGCCGGAGGATCAGTTTCCGGCGATATTATGTGTATTCACGGACGAATGGAGA
GTCCAACGTTCTGGTTAGGTATCGTCGGATTCGTGATCATAGCTTATTGTTTGGTAAAGAACGTGAAAGGAGCGATGATC
TACGGGATCGTCTTCGTAACGGCCGTTTCGTGGTTCCGTAACACAGAGGTAACGGCGTTTCCGAACACATCGGCCGGAGA
TGCAGCTCATGATTATTTCAAAAAGATCGTTGATGTACACGTCATTAAACATACCGCCGGAGCTTTAAGCTTCTCCGGGA
TAAACAAAGGACATTTCTGGGAAGCTCTGGTGACATTCCTCTACGTTGATATTTTGGATACGACGGGAACGCTTTACTCC
ATGGCTAGATTCGCCGGATTCGTCGACGAGAAAGGAGATTTCGCCGGACAGTATTTCGCGTTTATGTCTGACGCGTCTGC
GATTGTGATCGGATCGTTGCTTGGTACATCTCCGGTGACTGTTTTCATCGAGTCGTCGACGGGGATAAGAGAAGGAGGGA
GGACGGGTCTAACGGCGATTACGGTGGCTGTTTATTTCTTGTTAGCGATGTTTTTCACACCGTTGCTAGCTTCGATTCCC
GCATGGGCGGTTGGTCCGCCGTTGATATTAGTCGGAGTGATGATGATGAAATCAGTCACAGAGATTGATTGGGAAGATAT
GAGAGAGGCGATTCCGGCATTTGTGACAATGATTCTGATGCCGTTGACTTACTCCGTCGCGTATGGATTGATCGGAGGGA
TTGGGAGCTATGTAGTGTTGCATCTATGGGATTGGGGAGAAGAAGGTTTGGTGAAATTAGGGTTTTTGAAAAGGAAAGTT
AAAGAAGAGGATAATAATAATGGAGTTGTCAAAGCTAGTGAGATTGATACTACCGTTTAG