Details for Arabidopsis Locus AT3G10950

Position : Chr3 ( 5`- 3423893 .. 3424566 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10950

Protein [Map View]
MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDCGKVKAGGAYTMNTASAVTVR
STIRRLREQTES*

DNA
ATGACCAAGAGAACGAAGAAGGCTAGAATTGTCGGAAAATATGGTACACGATATGGTGCCAGTCTTAGGAAGCAGATCAA
GAAGATGGAAGTGAGTCAACACAACAAGTACTTCTGTGAGTTCTGCGGAAAGTACTCCGTTAAGAGGAAAGTTGTTGGCA
TTTGGGGGTGCAAAGATTGCGGGAAAGTGAAAGCAGGCGGTGCATACACAATGAACACGGCTAGTGCTGTGACTGTTAGG
AGTACCATCAGGCGGTTGAGAGAGCAAACCGAGAGCTAG