Details for Arabidopsis Locus AT3G10915

Position : Chr3 ( 5`- 3415958 .. 3417809 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10915

Protein [Map View]
MDSLSDIDGDFDGRNEGGSSSDYRLLGRQITVHQFMGGGKGEFFFPEFHFGYSRKWKTWQFIAADLLLWRRRHLSLGVII
ISTVAWLIFEFSGLPFLSVSSDVLLIVIMISFVHARVSAFRNRQLHSLPELVLSEEMVNSAAASFRIKLNHLLVMAHDVT
VGNDFRLFFKQVVICLWLLSAIGSYISLCTLLYIGTILSVTIPALYSKYQSKVDKCCGTIHRRLSHHYKIVDENVISRLS
WSLSKDKDS*

DNA
ATGGATAGTTTAAGTGATATCGATGGTGATTTCGATGGAAGAAATGAAGGAGGATCGTCATCGGATTATCGATTGTTGGG
TCGGCAGATTACGGTTCATCAGTTCATGGGTGGTGGCAAAGGCGAGTTCTTTTTTCCAGAATTTCATTTTGGGTATAGTA
GAAAATGGAAAACTTGGCAGTTCATAGCTGCTGACTTGCTCTTATGGAGGAGGCGACATCTTTCTTTGGGGGTTATCATT
ATATCAACTGTAGCCTGGCTTATATTCGAGTTTTCCGGGTTGCCTTTCTTATCTGTTTCTTCGGATGTCTTACTCATCGT
GATCATGATATCATTCGTTCATGCCCGGGTTTCTGCTTTTAGGAATAGACAGTTGCATTCGTTGCCAGAGCTTGTTCTAT
CAGAGGAAATGGTGAATAGTGCTGCAGCTTCTTTCCGTATAAAACTCAATCACTTGCTTGTAATGGCTCATGATGTCACA
GTTGGCAACGATTTTCGACTCTTCTTCAAGCAGGTGGTGATTTGTCTGTGGCTTCTCTCTGCCATTGGTAGCTATATATC
TCTCTGCACTCTTCTTTACATCGGGACCATCCTATCTGTAACAATACCGGCTTTGTACAGTAAATATCAAAGCAAAGTAG
ACAAGTGTTGCGGGACGATTCACAGGCGGTTGTCTCACCACTACAAAATAGTAGACGAAAATGTTATAAGCAGACTCTCA
TGGAGCTTATCCAAGGATAAAGATTCATGA