Details for Arabidopsis Locus AT3G10910

Position : Chr3 ( 5`- 3412911 .. 3414019 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10910

Protein [Map View]
MGRLLLEPQANAPANANPKPKGGINDTYFDTNMVIILAALLCALICALSLNSALRCVLRITRRFTSDDQVSNASNANANL
GRLAAATGLKKQALKQIPVGLYGSGIIDMKATECLICLGDFEDGEKVRVLPKCNHGFHVRCIDTWLLSRSSCPTCRQSLL
LEQPSPMAVSRRDEDMVVSIV*

DNA
ATGGGTCGGTTGCTACTTGAGCCGCAAGCAAACGCACCCGCCAACGCAAACCCTAAACCCAAAGGAGGCATAAACGACAC
CTACTTCGACACTAACATGGTTATCATTTTAGCTGCTTTACTCTGCGCTTTAATCTGTGCTCTAAGCCTCAACTCTGCCT
TGCGATGTGTGCTACGCATAACTCGGAGATTCACTTCGGATGATCAAGTCTCAAACGCTTCAAACGCAAACGCAAATTTG
GGACGTTTAGCGGCTGCCACGGGTCTCAAGAAACAGGCGTTGAAACAAATCCCCGTGGGACTGTACGGATCAGGAATCAT
AGACATGAAAGCTACGGAGTGTTTGATCTGTCTGGGAGATTTCGAAGATGGAGAAAAAGTTAGGGTTTTACCTAAATGTA
ACCATGGCTTCCACGTGAGGTGCATCGATACTTGGTTGCTCTCACGTTCCTCTTGCCCCACTTGTAGACAATCGCTACTC
CTTGAGCAGCCTTCGCCGATGGCTGTTTCCCGGCGGGACGAGGACATGGTAGTTTCCATCGTATAG